Conserved Protein Domain Family
EpsE

?
TIGR03028: EpsE 
polysaccharide export protein EpsE
Sequences in this family of proteins are members of a polysaccharide export protein family (pfam02563) which includes the wza protein from E.coli. This family of proteins are homologous to the EpsE protein of the methanolan biosynthesis operon of Methylobacillus species strain 12S. The distribution of this protein appears to be restricted to a subset of exopolysaccharide operons containing a syntenic grouping of genes including a variant of the EpsH exosortase protein. Exosortase has been proposed to be involved in the targetting and processing of proteins containing the PEP-CTERM domain to the exopolysaccharide layer.
Statistics
?
PSSM-Id: 132073
View PSSM: TIGR03028
Aligned: 4 rows
Threshold Bit Score: 432.684
Threshold Setting Gi: 499631573
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011397244  40 NYRLAPGDAIRINVFQQPDLTLDTRISENGSITYPLIGSLQLGGETLAAAEQQIAAGLRQGKYVKDPQVTITLLEIRGNQ 119 Hahella chejuensis
WP_011379604  26 DYPLGPGDILRIQVFQNPDLTTETRVSESGSITFPLVGALEVGGLSVASAENKLAAALKKGGFIKQPQVTIVLLQMRGSQ 105 Nitrosospira mu...
WP_011480247  32 DIVLGPGDVLRISVFEQPDLSLEVRVSESGTITYPLIGEVRVGGETPAAAERKIASMLESGGFLKNPHVNIIVAQLQSQQ 111 Methylobacillus...
WP_011312307  26 DYRMGVGDVVRITVYGQPDLTTDARVSAKGNISFPLIGEVKLAGTTPAEGEREIASRLSKGGFVVQPFVTLNVVQYRGQQ 105 Thiobacillus de...
WP_011397244 120 VSVLGQVSRPGRFPLDTQkTRLSDVLAMAGGVTASGSDIVVVSGIREGRPFHKEVDFPSIFSQGERNENILVAGGDVIFV 199 Hahella chejuensis
WP_011379604 106 VSVLGQVNRPGRFPLETL-SRVSDMLAAAGGTTPLGDDFAIVTGTRNGQAFRKVIDIPALYLEERSDEDIILAGGDTIYV 184 Nitrosospira mu...
WP_011480247 112 VSVLGQVNRPGRYPLDSA-KSLADVLALAGGVAPDGGDLISLVRKIEGKSVREIIDFAEMMRDGDLNKNILLTAGDIIYV 190 Methylobacillus...
WP_011312307 106 VSVLGRVNRPGKYPLEKA-GRVSDALALAGGILPDGADVITLVRERDGKIEYRQIDVLALFNPGGDPNNVVVQDGDIINV 184 Thiobacillus de...
WP_011397244 200 DKAPVYYIYGEVQRPGVYRVERNMTVQQALAQGGGISLRGTDNGIKVYRKDAKGDVELKESELYDPVRADDVIYIRESLF 279 Hahella chejuensis
WP_011379604 185 HRAPVFYIYGEAQRPGAYRIERGMTVMQALAQGGGPTPRGSEWWLRLHRRNADGVVEKLSPDMTDAVQPNDIIYVRESIF 264 Nitrosospira mu...
WP_011480247 191 DRAPRFYIYGEVQRPGQYRLEYHMTVLQALAVGGGLSLRGTEKGIKVKRLDDEGGVKIIKVKHDDFIQPNDVVYVQESVF 270 Methylobacillus...
WP_011312307 185 ARQPMFYIYGEVQRPGAFRLEQNMTLMQALSMGGGLTPRGTQRGIRIMRRDDKGAVREVSGELGDLVKPDDVIYVKESLF 264 Thiobacillus de...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap