Conserved Protein Domain Family
pepcterm_export

?
TIGR03027: pepcterm_export 
putative polysaccharide export protein, PEP-CTERM sytem-associated
This protein family belongs to the larger set of polysaccharide biosynthesis/export proteins described by pfam02563. Members of this family are variable in either containing of lacking a 78-residue insert, but appear to fall within a single clade, nevertheless, where the regions in which the gene is found encode components of the PEP-CTERM/EpsH proposed exosortase protein sorting system. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 132072
View PSSM: TIGR03027
Aligned: 12 rows
Threshold Bit Score: 221.03
Threshold Setting Gi: 490647925
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_004512920  39 YVVGDGDSLMISVWGEKELSGTVTVRPDGKITLPAIGDVIASGFTPTKLSEDLAEKLAKVVNKPIVTVTVNTvtnnkiyv 118 Geobacter metal...
WP_011112353  41 YLIGPGDTLNIIVWRNPEISMSVPVRPDGKITTPLVEDLPASGKTSTELARNIEETLSKYLQQPVVTVVITG-------- 112 Nitrosomonas eu...
WP_011330824  44 YIIGPGDQVDIFVWGNEELSSSIIVHPDGRLTSPLVEDLQASGKTPTELARDIEKILSRYVRAPIVTVIVNE-------- 115 Nitrosococcus o...
WP_011381817  44 YLIGPGDNVDIIVWRNPEVSMAVPVRPDGKITTPLVEDLSASGKTSTQLARDIEEALSKYIQQPVVTVVVTE-------- 115 Nitrosospira mu...
WP_011045744  47 YLIGSGDVLNIFVWRNPEVSGSFVVRPDGMITTSLVEDIEVSGKTPTELARSIEKILATYLRDPIVTVTVEN-------- 118 Colwellia psych...
WP_011310794  43 YLVGPGDSVNVFVWRNPEVSGTFPVRPDGKMTMNLVEDLQASGKTPTQLARDIEKALGKYIQEPIVTVIVGG-------- 114 Thiobacillus de...
WP_011238214  48 YVIGPGDSVNIVVWRNPELSMAVPVRPDGKITTPLVEDLPALGKDSSTLARDIEQALAKFIREPVVTVIVTS-------- 119 Aromatoleum aro...
WP_011288132  44 YKIGPGDNLNIVVWRNPELSMVVPVRPDGKISSPLIDDLNAMGKDSTSLARDIEKELAKYIRDPVVTVIVTG-------- 115 Dechloromonas a...
WP_011390865  45 YVVGPGDSLDVFVWGQPDLSRSIVVRPDGRLTLPLVTDLVAAGKTPSELSAAITEQLQTYVQNPVVSVMVVN-------- 116 Rhodospirillum ...
WP_011396570  47 YILGPGDVVNINVWRNPELSGSVPIRPDGKLSTTLVGDIVASGKTPAQLAEEIKQKLSVYIREPQVSVVVTG-------- 118 Hahella chejuensis
WP_011176616  25 YIINHGDGISVNVWGEKELSVKVTVRPDGRITLPGIGDMDAAGQTAEQLQAKITTRYAELVRNPVVTVSVDMsqnnsviv 104 Desulfovibrio v...
WP_011366891  26 YVIGSGDGLLVNVWGEQELNVAIAVRPDGMITVPGVGEVMAQGKTPQQLTTELSRKLAELVRNPIVTVSVTQvrnnsvtv 105 Desulfovibrio a...
WP_004512920 119 fgggvpsgvavlpsrttllqflirygnfkgidlgnayllrngkkmdvdfhsllvkgdvakdvplkpedmiYIPdNEAYKI 198 Geobacter metal...
WP_011112353 113 ----------------------------------------------------------------------FVG-PFSEQI 121 Nitrosomonas eu...
WP_011330824 116 ----------------------------------------------------------------------FIG-RFSEQV 124 Nitrosococcus o...
WP_011381817 116 ----------------------------------------------------------------------FVG-PYSEQI 124 Nitrosospira mu...
WP_011045744 119 ----------------------------------------------------------------------FVG-PFSEQI 127 Colwellia psych...
WP_011310794 115 ----------------------------------------------------------------------GIG-PFDQQI 123 Thiobacillus de...
WP_011238214 120 ----------------------------------------------------------------------FVG-PYSEQI 128 Aromatoleum aro...
WP_011288132 116 ----------------------------------------------------------------------FVG-PYSEQI 124 Dechloromonas a...
WP_011390865 117 ----------------------------------------------------------------------FAG-PFDKQV 125 Rhodospirillum ...
WP_011396570 119 ----------------------------------------------------------------------MQSyEFSSRV 128 Hahella chejuensis
WP_011176616 105 hgpgvkpgmvpmagrttllqlltriapeatadldgatltregtvlrtgfrdlyergaiaddvelkpgdrvFIPfRAKWSV 184 Desulfovibrio v...
WP_011366891 106 hgagvqaavvplersttllellaqlspgdtadfdnaylsrqgrrivsgftglfvkgetendvalqpgdriFIPyRADRNV 185 Desulfovibrio a...
WP_004512920 199 YVMGAVANPKYVFYRDGLRILDAIIETGGFTKFAKENDVLIVRKEGTSTTEISAKVKDLMKEGDMTQNVHLKPGDFVIVK 278 Geobacter metal...
WP_011112353 122 RVIGEAAQPQALPYRENMSLMDVMIAVGGLTDFAAGNRARIIRNVDGEQQQFRVRLEDLIRDGDISANVPVYQGDVLVIP 201 Nitrosomonas eu...
WP_011330824 125 RVVGEAADPSALSYQEHMSLLDVMIEVGGLTEFAAGNSATLVRTANGREKQFSVRLDDLIRDGDITANVEILPGDILIIP 204 Nitrosococcus o...
WP_011381817 125 RVIGEAAEPQALPYREEMTLMDVLIAVGGMTDFAAGNRARIVRNVDGKQHQFSVRLDDLIRDGDVTANVPMKQGDVLVIP 204 Nitrosospira mu...
WP_011045744 128 RVIGEAAQPRAINYTQHMTLLDVMIQVGGLTEFADGNDAVLIRIESGTQNQYQVMIDQLLKDGEISANVDMLPGDIIIIP 207 Colwellia psych...
WP_011310794 124 RVVGEAAKPQALNYREKMSLVDLMIAVGGLTDFAAGNKAYILRTVDGKQERLGVRLEDLLRGGDVSANVDMRPGDVLVVP 203 Thiobacillus de...
WP_011238214 129 RVVGEAATPQVLPYVQKMTLLDVMIAVGGVTEFADGNGASILRTGEGN-KQYSVRVKDLLKRGDVSANVEMRPGDVLIIP 207 Aromatoleum aro...
WP_011288132 125 RVIGAATKPQILAYKQKMTLLDVMIAVGGITDFADGNGATILRTSENNA-QYSVRIKDLVKRGDVSANVEMKPGDVLIIP 203 Dechloromonas a...
WP_011390865 126 RVVGEAATPKALQYRDRMTTLDAMIEVGGLKQFAAGNRAVLVRGQPPEAKSYRVRLEDLMNDGDITANVPLMPGDVLIIP 205 Rhodospirillum ...
WP_011396570 129 RVTGAVKSPISIPYRHGMTVMDVVLTAGGLNDFANGDSSVLYRQYQGKSVIIPVKLNEIFQEGDVTTNYELNPGDIITVP 208 Hahella chejuensis
WP_011176616 185 YVVGAVNEPMTLTYHEGMTLMEALLAAKGFTRFADRNKTEVVRERDGRQEVVVVRAGDLIDKGDLTQNVPLQAGDYVIAK 264 Desulfovibrio v...
WP_011366891 186 FVMGAVNNPMAIPHHDGLSVLEALLEAGSFNKFADRNNTVIVRHDGVEKKSIAVRGGDLVNDGDLTQNLELQPGDYVIVK 265 Desulfovibrio a...
WP_004512920 279 ESIF 282 Geobacter metallireducens
WP_011112353 202 ESFF 205 Nitrosomonas europaea
WP_011330824 205 EAWF 208 Nitrosococcus oceani
WP_011381817 205 ESYF 208 Nitrosospira multiformis
WP_011045744 208 EAWF 211 Colwellia psychrerythraea
WP_011310794 204 ESLF 207 Thiobacillus denitrificans
WP_011238214 208 QSWF 211 Aromatoleum aromaticum
WP_011288132 204 QSWF 207 Dechloromonas aromatica
WP_011390865 206 QSWF 209 Rhodospirillum rubrum
WP_011396570 209 EKVL 212 Hahella chejuensis
WP_011176616 265 KGLF 268 Desulfovibrio vulgaris
WP_011366891 266 KSFF 269 Desulfovibrio alaskensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap