Conserved Protein Domain Family
pepcterm_femAB

?
TIGR03019: pepcterm_femAB 
FemAB-related protein, PEP-CTERM system-associated
Members of this protein family are found always as part of extended exopolysaccharide biosynthesis loci in bacteria. In nearly every case, these loci contain determinants for the processing of the PEP-CTERM proposed C-terminal protein sorting signal. This family shows remote, local sequence similarity to the FemAB protein family (see pfam02388), whose members [Unknown function, General]
Statistics
?
PSSM-Id: 132064
View PSSM: TIGR03019
Aligned: 11 rows
Threshold Bit Score: 479.542
Threshold Setting Gi: 497737128
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011390861  12 AAWDLFVE-SCPQGTFFHRAGWQRVIDQAFGQTNHFLYAEQ-DGAIVGVLPLTYVRSPLFGNRLVSTAWCVGGGAAVVEA 89  Rhodospirillum ...
WP_011381811  33 RRWDDFVS-CCREATFFHRAGWQTVIERAFGHKTWFLYAEC-EGEIQGVLPLAEINSRLFGHSLSSLPFCVYGGIAADSQ 110 Nitrosospira mu...
WP_011288139  15 ARWDAFVY-ASPEATFFHRADWQGIIREVFKHPTWYLYAEE-NGEIVGVLPLAQINSLLFGNSLTSLPFAVYGGVVASRP 92  Dechloromonas a...
WP_002810978  25 NRWDEFVE-AHPEATFFHLAGWREVLERAYGHATHYFYAEQ-DGKIVGLLPLARIRSRLFGDALISTPFCVYGG-AVGSR 101 Nitrosococcus o...
WP_011238221  17 GRWDAFVR-GCPDATFFHLSAWQGIIREIFRHRTFFLYAER-AGDIIAVLPLAEVNSRLFGHALTSLPFCVYGG-PAGDP 93  Aromatoleum aro...
WP_011310801  26 ARWDTYVA-AHPGATFFHRAGWKRVIEDAFAHRTHFLLAER-AGEIVGVLPLAEIKSRLFGHSLGSLPFCAYGGILADDD 103 Thiobacillus de...
WP_011712277  19 QAWDRFVE-AAAGGSFFHLAGWQRLLSGLYKHPTYYLYGQR-DGQVVGVLPLARVRSRLFGDALISTPFCVYGGVVAQDL 96  Magnetococcus m...
WP_011396575 126 ASWDDYVD-QHPQSSPYHKIWVKSFVESVYGHPCRFICALDeTDRIVGVLPLTQLNSRLFGNFIVSAPYFNYGGILADSR 204 Hahella chejuensis
WP_011787328  18 ALWDAYVA-AHAESTGYHRMGWTRVAQRAFGHAAYPLAAFD-GGRIAGVLPLVHIRSRLFGRFLVSLPFVNYGGLLADSA 95  Desulfovibrio v...
WP_010051312  28 ADLAAFVRhSAPEVPLSKHPLWLDVLRSSLGHEVYALEATA-SGRTVGFLPLACVDSVLFGRFLVSLPYLNTNGVIAPTA 106 Gemmata obscuri...
WP_011112347   1 -------M-ACPEATFFHRAGWKQVIEQAFGHKTWFLYIEE-GGCIQGVLPLAEIDSLLFGHSLSALPFCVYGGIAAISD 71  Nitrosomonas eu...
WP_011390861  90 AAAEALERAAVDLLMAGPARYIEIRDPAV-PHgegSGWQCK-EgLYAAFERPIAASDEACLTAIPRKQRAVVRKAIDSGL 167 Rhodospirillum ...
WP_011381811 111 TVRDALDRSAQKLAQELQVDYLEYRNLKP-HH---ADWHGK-D-LYVTFRKEIASEIEQNMSAIPRKQRAMVRKGIKAGL 184 Nitrosospira mu...
WP_011288139  93 DVVSMLEQEAQKLAQELKVDHLEFRNLTP-RH---SEWPIQ-D-LYVTFRKEILPDVEANMLAIPRKQRAMVRKGIKNGL 166 Dechloromonas a...
WP_002810978 102 EACDALEAAAYRVAWDLGVDYLELRNLQL-RH---SDWPCS-E-LYVTFRKNIDPDPEKNLAAIPRKQRAMVRKGIKAGL 175 Nitrosococcus o...
WP_011238221  94 EGIALVEAEAETLARRLRVQHLELRNLTP-RH---EEWPRQ-D-LYVTFRKEIQADDDANLLAIPRKQRAMVRKGIRHGL 167 Aromatoleum aro...
WP_011310801 104 EAARALDAAAQALATRLGVGALEYRNQVA-QH---PDWPTK-D-LYVTFKKAIAPEVEANMNAIPRKQRAMVRKGIKAGL 177 Thiobacillus de...
WP_011712277  97 QVQEALLDEARWLTARLNVAHLELRSVTP-LD---DGWINK-P-LYATFRKPIVAEPAANLREIPRKQRAEVRRGIQAGL 170 Magnetococcus m...
WP_011396575 205 QVAQILLADAVRWRDQVGAGHIELRHLTP-SS---LRLPQR-T-EKLTFWLALPQQEDDLWLSFKPKVRAQIKRPQKEGA 278 Hahella chejuensis
WP_011787328  96 EAAQALIDEAEGLLRRTGAGSIELRHVGP-PR---LGLSAK-S-HKVTMLLDLPDDPDTLWRGLRDKVRNQVRKAGKSGL 169 Desulfovibrio v...
WP_010051312 107 DVRAELIARAAGLADELNVRHLELRHEAPvAH---PALTASiT-SKVHMRLALPSTPERLWKGFDTKVRNQIRKGEKGGF 182 Gemmata obscuri...
WP_011112347  72 DARIRLDQAAQMLATYLKVDYLEYRHLHP-FH---HDWPTK-D-LYVTFRKTMDSDVEQNMLAIPRKQRAMVRKGMKYEL 145 Nitrosomonas eu...
WP_011390861 168 QGRFDDD--PSTFYELYALSMRNLGTPVFSKPYITLLRDVFGVDTTTIYTVyGDQRPLSSVLNFTFRDKIMPYYTGADPE 245 Rhodospirillum ...
WP_011381811 185 ESVVDQD--IERFFSAYSASVHRLGTPVFSRKYFRLLKEVFAEDCELMIIV-KDNRTISAVMSFYFRDEVLPYYGGGTGE 261 Nitrosospira mu...
WP_011288139 167 ISTVDPT--CDRFFSLFADNVHRHGTPALPKRYFDSLLRTFGNDCEILTVTgPDGRILSSVLSFYFRDEVLPYYAGDDEA 244 Dechloromonas a...
WP_002810978 176 TSSTDSD--IERFFLIYSESVRNLGTPVFPKRYFEILKTVFGDRCEVLTIF-HEGTPISSVMSFYFRDEVLPYYGGGLAG 252 Nitrosococcus o...
WP_011238221 168 TSRVEPD--VERFFSLYADNVLRHGTPALPKAFFARLMKDFGPDCEVLTVSdADGNALSSVLSFYFRDEVLPYYAGDAVM 245 Aromatoleum aro...
WP_011310801 178 VGEIDGD--TRRFFEAYSASVHRLGTPVFSRRFFRLLKDAFGDDCEVLTITl-KGEVIASVISFYFRDEVLPYYGGGTDA 254 Thiobacillus de...
WP_011712277 171 VTRLLQN--PDPCYRIYAESLRNLGTPVFARAHFQTLKQIFAERCEVAVVE-QHGVAVSGVLSFYFRDQVLPYYGGALPH 247 Magnetococcus m...
WP_011396575 279 EVTIGGAelLDDFYAVFSRNMRDLGTPVYGRNFFYGFLSSYGESARVVIGRlNKTVVACAIVIGHGRRMEIP-WASTLQE 357 Hahella chejuensis
WP_011787328 170 TVEQGGAglLGPFYDVFAVNMRDLGTPVYSRRFFETIMDEFPGATRIVAVRdGDAVVAAALCYTHGNTFEVP-WASSLRT 248 Desulfovibrio v...
WP_010051312 183 AVTWGGAecLDGFYDVLAENMRDLGSPVYGIELFRAILATFPGDAEICLVRsGATPVAAALLLHGWGVTEVP-TASSLRD 261 Gemmata obscuri...
WP_011112347 146 QSYLDQD--TDHFFRAYSASVHRLGTPVFSRKYFRLLKSVFAEDCELLIIT-KDENVVSAVMSFYFRDEVLPYYGGGTDA 222 Nitrosomonas eu...
WP_011390861 246 ARKQGAADLMYYGVMCAARARGLGVFDFGRSKVGTGPFAFKKNWGFTPRPVIHEYLVKDGGPMPDVNPTNPKYRAMIALW 325 Rhodospirillum ...
WP_011381811 262 AREVAGNDFMYWELMRRACEKGCKVFDFGRSKRGSGSFDFKKNWGFEPQPLHYEYQLHQAKEVPDHNPLNPRYQIFIKAW 341 Nitrosospira mu...
WP_011288139 245 ARDQAANDFKYWELMRRACERGLKIFDYGRSKVGTGPYAFKKNWGFEPRPLSYEYCLYKGNDIPQNNPSNAKYKLFIAAW 324 Dechloromonas a...
WP_002810978 253 AREFKANDFMYWELMRRASEQSVRVFDYGRSKLDAGSYRFKTHWGFKPQPLHYEYKLIKANKVPEKNPLNPRYRLFVEGW 332 Nitrosococcus o...
WP_011238221 246 ARDVAANDFKYWELMRRAAARGCRLFDFGRSKIGTGPFSFKKNWGFEPQPLSYEYRLYRRDSVPQNNPMNPKYRAFIALW 325 Aromatoleum aro...
WP_011310801 255 ARAVAGNDFMYWDLMRRACERGLKVFDFGRSKRGTGAFDFKKNWGFEPTPLHYEYFLVADSTVPEINPLNPKYRLFIEAW 334 Thiobacillus de...
WP_011712277 248 GRQVGAYPYMYYDLMNRAAAQGCRWFDFGRSKRGTGAYDFKRFYGFSPQPLHYGYYLYERRELPDLNPLNPKYQRFIALW 327 Magnetococcus m...
WP_011396575 358 ANSSGINMLMYWEILKFSIHQKYQIFDFGRCTEGSGTYKFKQQWGATPVRLHWDYCLAEGRDAPKLNPDNPKFKLVIAVW 437 Hahella chejuensis
WP_011787328 249 HRDRCPNNLMYWHCMETACREGFTVFDFGRSSRDSGPWRFKAQWGAREVPLSWEYLLADGAPLPDLNPSSARFSLAVRVW 328 Desulfovibrio v...
WP_010051312 262 YNPSNVNMLMYHALLLRSVERGQRVFDFGRSTADGSTFKFKKQWGAVPHPAAWQYAVQRG-EVGEMRPDNPRYRLAIRLW 340 Gemmata obscuri...
WP_011112347 223 ARDLAGNDFMYWELMRRACERGYRVFDFGRSKRGTGSYSFKKNWGFEPQPLFYEYQLHQAKTIPEHNPLNPKYQLFIKAW 302 Nitrosomonas eu...
WP_011390861 326 RRLPLAVANTLGPWISRQVG 345 Rhodospirillum rubrum
WP_011381811 342 QKLPLGLANLVGPHIVRNLG 361 Nitrosospira multiformis
WP_011288139 325 RRLPIGLANLLGPHIVRNLG 344 Dechloromonas aromatica
WP_002810978 333 KRLPMPLTRLVGPWIARDLG 352 Nitrosococcus oceani
WP_011238221 326 RRLPIRVANAIGPHIVRNLG 345 Aromatoleum aromaticum
WP_011310801 335 KRMPRALANAIGPHIVKNLG 354 Thiobacillus denitrificans
WP_011712277 328 RRLPLAVANGLGPLLARNLG 347 Magnetococcus marinus
WP_011396575 438 KRLPVWLTNMVGPLLVKYLP 457 Hahella chejuensis
WP_011787328 329 RHLPVALTRFIGPHIVRSIP 348 Desulfovibrio vulgaris
WP_010051312 341 QKLPVELTRAFGPRIVRGIP 360 Gemmata obscuriglobus
WP_011112347 303 QKMPLALANMLGPHIVKNLG 322 Nitrosomonas europaea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap