Conserved Protein Domain Family
EpsF

?
TIGR03017: EpsF 
chain length determinant protein EpsF
Sequences in this family of proteins are members of the chain length determinant family (pfam02706) which includes the wzc protein from E.coli. This family of proteins are homologous to the EpsF protein of the methanolan biosynthesis operon of Methylobacillus species strain 12S. The distribution of this protein appears to be restricted to a subset of exopolysaccharide operons containing a syntenic grouping of genes including a variant of the EpsH exosortase protein. Exosortase has been proposed to be involved in the targetting and processing of proteins containing the PEP-CTERM domain to the exopolysaccharide layer.
Statistics
?
PSSM-Id: 132062
View PSSM: TIGR03017
Aligned: 5 rows
Threshold Bit Score: 667.669
Threshold Setting Gi: 499631572
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q1GZP5         1 MSFIRFISIIKARYKIIIFTLFITVLTTAIVTILLPKNYKATASVLVNYKGADPVTGVMLPAQLMPGYMATQVDIISSKN 80  Methylobacillus...
BAC55136       1 MNLNQIVLILLARYRIVLITFALTVFTVLVISLLQSKVYQATASVVLNYKGTDPVTGAVVPGNMALGYVPTQIDIINSQH 80  Methylobacillus...
WP_011397243   1 MTLKHVLLVLWARRWVVLSVLLATITTTAVVSLLIPKEYTASTTVVLDVQTPDRIVGMVLPGMMSPGYMATQMDIITSDR 80  Hahella chejuensis
WP_011379605   1 MTLQQFLLILRARYKVVLYILLFTVIATLVVSLLLPKQYTAGTAVVVDIKSPDPVAGMVLPGLTSPTYMATQVDVINSDR 80  Nitrosospira mu...
WP_011312306   1 MNFTQLLLVLYARKWIVLGVLLVAVTATAVVSFLLPKEYSATTMVVIDSKSKDPVTGQLMPSQMFPGYMATQVEIIQSAR 80  Thiobacillus de...
Q1GZP5        81 VAKKVIDKLGLADVPAVKEDFYQATSGKGEIKEWLADLLLKKLQVKPSRESSIIDISFFGVNPQFAATIANEFAESYMQT 160 Methylobacillus...
BAC55136      81 VALKVVDELRMAENENVKAKFEEDTGGRGDLRFWLADLLLKKLTVTPGRDSSVIEIMFEGSDPDFVALVANAFANAYQET 160 Methylobacillus...
WP_011397243  81 VAQGVVRLLKLDENPETREKWLEETGGQGSLAVWLAPGLKKNLEVSPARESNVISVEFSATDPRFAATAANAFAQAYIDT 160 Hahella chejuensis
WP_011379605  81 VAERVVKMLRLDESPVVKEQWEED-GSKGELTTWLANLLKRKLDVKPSRESNVIYIEYTGNDPNFAAAVANAFAQAYIDV 159 Nitrosospira mu...
WP_011312306  81 VARNVVRALKLDESPAIRQQFMDATQGQGSIEQWLGDLLLEKLEVEPSRESSAISIEYSGADPRFAAIVANAFAKAYIDT 160 Thiobacillus de...
Q1GZP5       161 SIQLKVEPSQKAALYFVEQLKELREDLAQAQSKLSEYQQEKGIVSVDERLDVERARLNELSSQLVIAQAQVMEARSREKN 240 Methylobacillus...
BAC55136     161 NVEMKVEPAQKAAEYFGTQIQALRDNLSKAQSRLSKYQRENGYTSSDERMDVEASRLNWLSEQLVAAQGQSIEADSRSGG 240 Methylobacillus...
WP_011397243 161 TIDLRAEPARKYAAWFEQQYETQRERLQRAQKALSDFQQQTGIVVTNDRLDFENQKLGELTAQLSLALAEGTDSSSKQGF 240 Hahella chejuensis
WP_011379605 160 NLDLKVAPARQYAHWFKGQTAAARDELERAKAALSAYQQETGLVATEERLDYEVAKLNELSSQLTLIQAQTSDSSSKRKA 239 Nitrosospira mu...
WP_011312306 161 NLELRVAPAKEATTWYDQQIAQLRAKLDEAQQKLTAYQREKGLVESDQRLDVETARMAELAAQMVAAQSAAFDASSKVRG 240 Thiobacillus de...
Q1GZP5       241 SSGkEAYesPDVAANPIIQNLKTEIARAESRFADVSQKFERNHPFYLGAKAEIENLKSELDRQIKSVSSNVASNSRILQQ 320 Methylobacillus...
BAC55136     241 SRK-NALesPDVVSNPIIQNLKINLATAESKLAELSQRLDKNHPQYQAAEAEINKIKSQLNAEVKTVTGSVGNGAGIQKQ 319 Methylobacillus...
WP_011397243 241 HQGgDTL--PEIMRNPLIIQLKTDIARLESRLQELSEDYGVNHPQYKSAASELASMKSRLRMETAKIAESISTVGRVSKA 318 Hahella chejuensis
WP_011379605 240 AEDpDTL--AEVIQSPLINSLKSDIARLDAKLQESSAYLGPNHPQTKRTQSELASLRGKLSAETRKIHSSIGTSYEVGKR 317 Nitrosospira mu...
WP_011312306 241 SGD---L--PEVINNPVVQSLKGKVAATEGKLAELARRVGPNHPEYVRLQAEANSYRSQLNEEIARATRAVEATSGAAKQ 315 Thiobacillus de...
Q1GZP5       321 REAEIRLALNNQKEKVLQLNRDRDILSVLTREVENAQKAYDMAMQRYTQTNIEGQSNQSDISLLNPAVAPLTPTSPNLLL 400 Methylobacillus...
BAC55136     320 RVAELQAQVDKQKAVLVEMNRTRDEMLVLQKDVEMAQRAIEGAMLRFSQTSIESKSNQSDVAILNTATSPLLPSGTRTLL 399 Methylobacillus...
WP_011397243 319 KQAELKEAIEEQKKKMLELKSQHDQIQILSHQVETAQRDFDAISQRLTQSQLEAQTVQTNVSVLTPASPPLRHSKPILFL 398 Hahella chejuensis
WP_011379605 318 KEQELLEAMERQKGRVLELNRQRDQMSVLQGDVEAAQRNFEGISQRSALTRLESLSVQTNITPLNPASVPSEPSSPKLLL 397 Nitrosospira mu...
WP_011312306 316 RLGGISGAFEAQKARVLDLKKQREEATLLARDVESAQRVYDAALQRYSQTRMEAESTQTDIGILNPAVPPLEPSSPRIVL 395 Thiobacillus de...
Q1GZP5       401 NIILSILLGMFLGIGFGVLAEFVDRRVRTADDLIEVLQAPLLGTIS 446 Methylobacillus flagellatus KT
BAC55136     400 KLALGAIIGMLLGIGFAFVSEFMDRRVRSKDDISAILDVPVFALID 445 Methylobacillus sp. 12S
WP_011397243 399 NLVIAVMLGGLLSVGAALILELRNPVVRSIEDLQSALGVPVLAQLG 444 Hahella chejuensis
WP_011379605 398 NTLISIFLGTLLGVSAALVMELMNRRVRSVEDIVEAIEIPVLAVMS 443 Nitrosospira multiformis
WP_011312306 396 NIVLSIFLGGLLGMGIGFLVELWDRRVRSAQDIAE-LDIPLLAEVG 440 Thiobacillus denitrificans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap