Conserved Protein Domain Family
pepcterm_ATPase

?
TIGR03015: pepcterm_ATPase 
putative secretion ATPase, PEP-CTERM locus subfamily
Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems. [Protein fate, Protein and peptide secretion and trafficking]
Statistics
?
PSSM-Id: 132060
View PSSM: TIGR03015
Aligned: 9 rows
Threshold Bit Score: 471.859
Threshold Setting Gi: 490647929
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011381813   1 MYTSFYGFKAKPFQLSPDPSFFFGSKGHNRAMAYLEYGLAQAEGFIVVTGEVGAGKTTLVRNLFRQLEPEKIVAAQIVNT 80  Nitrosospira mu...
WP_011238218   1 MYESYFKLRAKPFQLNPDPAFFYGSRGHRRAMAYLEYGLHQNEGFIVVTGEIGAGKTTLVRSLLERLEPSKVVAANLVST 80  Aromatoleum aro...
WP_011288136   1 MYEAFYGLTSKPFQLNPDPSFYFGSKQHRRAAAYLEYGLHQNEGFIVITGEVGAGKTTIVRGMLDSLDQDKVIAAHLVST 80  Dechloromonas a...
WP_011310798   1 MYEDYYRFSAKPFQLNPDPRFFYGSKGHKRAMAYLDYGLSLGEGFIVITGEVGAGKTTLVRNLFRQLEAHNLVAAQLVST 80  Thiobacillus de...
WP_011112349   1 MYLAYYGFAEKPFQLKPDPNFFFPSRGHKRAAAYLEYGLSQEDGFIIITGDVGAGKTTLMRYLFQKLRQERVAAAQLVST 80  Nitrosomonas eu...
WP_010942626   1 MYEAYFNLTTKPFELLPNPDFIFPSKSHKRALMYLDYGISERAGFILLTGDIGTGKTTLIRNMIQLKD-ERTIISRIFNT 79  Geobacter sulfu...
WP_004512924   1 MYEEFFGFTTKPFELVPDPEFLYLSRVHKKAITYLEYGIRERNGFLLITGEIGSGKTTIIRNILKSLD-EQVTLSKIFNT 79  Geobacter metal...
WP_011366894   1 MYNEFFHLRTKPFELLPDPDFLYPSKAHRKALAYFEYGLSERSGFILLTGEVGSGKTTLIREMLKR-DLGRMVLSKVFNT 79  Desulfovibrio a...
WP_011176619   1 MYTAFFGFRVKPFDLLPNPDFLYPSRAYRKASAYLEYGVRDRAGFILITGEVGAGKTTLIRSLLKRSL-GDVLISKVFNT 79  Desulfovibrio v...
WP_011381813  81 SLDSDDTLRMVAAAFGLPLAQgnPGKTPVLVALEKFFRQCEQQGKRALLVVDEAQNLSPQTVEELRMLSNFQGDNKSLLQ 160 Nitrosospira mu...
WP_011238218  81 QVDQNDILRMVAVAFGVPSRG--LDKAGLLLALETYFVSLAAAGKRALLIVDEAQNLYEEAVEELRMLSNFQLEDHALLQ 158 Aromatoleum aro...
WP_011288136  81 QLDADDTLRLVGAAFGLRTKD--VSKADVLMTLEAFLISMTGKGKRCLLVVDEAQNLTQRAVEELRMLSNFQFGNHALLQ 158 Dechloromonas a...
WP_011310798  81 QLDAEDTLRSVAASFGLEHEG--LTKSALLKNLESFLAAAARQGKRALLVVDEAQNLTPRAVEELRMLSNFQNDERSLIQ 158 Thiobacillus de...
WP_011112349  81 RLDPDDALRMVAAAFGLSYEG--LSKAALLLELERFMRKCERESTRVLLVVDEAQNLLPQTLEELRMLSNFQSDNRPLLQ 158 Nitrosomonas eu...
WP_010942626  80 RVEPEQLLAMICHDFGIPAEG--RGKVALLNELNDYLIEQFALGNRPVLIIDEAQNLSADLLEDIRLLSNLETSDTKLLQ 157 Geobacter sulfu...
WP_004512924  80 KVTSEQLLAMINDDFGLDVAG--KDKIALLRQLNEFLVDEFVAGRQPVILIDEAQNLDIDLLEEVRLLSNLETDKSKLVQ 157 Geobacter metal...
WP_011366894  80 RVDSTQLVAMINDDFGLETAG--RDKMVMLRDLNDFLIDQYAAGRRAVLVIDEAQNLSQELLEEVRMLSNLETDSAKLLQ 157 Desulfovibrio a...
WP_011176619  80 SVDAEQLVAMINDDFGLETDG--RDKVAMLRDLNTFLIEQYAERRRPVLIIDEAQNLTPEVLEEVRMLSNLETDNAKLLQ 157 Desulfovibrio v...
WP_011381813 161 TFLLGQPEFRKTLLGNDMQQLRQRITATYHLGPMDRAETKSYIEHRLKTVGWGGNPGFDEEAFDAIHQYTGGIPRRINAL 240 Nitrosospira mu...
WP_011238218 159 SFLVGQPEFREVMQSPQMQQLRQRVIASYHLGPMDAEETRAYIEHRLHHVGWENDPVFAPAAFDAIYGYTGGIPRRINAL 238 Aromatoleum aro...
WP_011288136 159 SFLVGQPEFRHILQSPNLMQFRQRVIAACHIGPLDVDETKSYIDHRLKCAGANDSIVISPDAHEAIFKASSGIPRRINSV 238 Dechloromonas a...
WP_011310798 159 TFLLGQPEFRGILQSPDMQQLRQRVVASYHLGPLDADETRGYIEHRLRTVGWQGMPGFDDDAFAALHRFSGGIPRRLNTT 238 Thiobacillus de...
WP_011112349 159 TFLLGQPEFRRTLLGSQMQQLRQRVIATYHLGPLDQAETRAYIEHRLQKAGWNGSPVLQDEIFEVIHNFSAGIPRKINLF 238 Nitrosomonas eu...
WP_010942626 158 IVLVGQPELREVLALPQLLQLRQRISINCHISPLSREETEGYIFHRLDRAGNRNAVAFSSDALDIVYRYSRGIPRLVNII 237 Geobacter sulfu...
WP_004512924 158 IILVGQPELRRTLANDRLRQLRQRICISCHIDHLSKAEVEEYIFHRLEKAGNRTAVEFGEGAIDLIYLFSRGVPRLINII 237 Geobacter metal...
WP_011366894 158 IILVGQPELRDLLRSPALVQLRQRIQVHCHIAPLSQEELREYVLFRLERAGNRDAMEWGEGVFGLMHEATRGIPRLVNIL 237 Desulfovibrio a...
WP_011176619 158 IILVGQPELRERIRSPQLLQLRQRILVQCHLEPLTREEVEEYVLYRLERAGNRDALHWEEGVMAEMHRATRGIPRLVNIL 237 Desulfovibrio v...
WP_011381813 241 CDRLLLMGYLEKLQHFGVSEVNEVIRDIQQE 271 Nitrosospira multiformis
WP_011238218 239 CDRLMLSAFLAERHEVSGEDVREIVAELKEE 269 Aromatoleum aromaticum
WP_011288136 239 CDRLLLFGFLSNKKEFKAEDVEEVAREIYEE 269 Dechloromonas aromatica
WP_011310798 239 CDRLLLFGFLEEKRHFGEAEVDEVIADLRSE 269 Thiobacillus denitrificans
WP_011112349 239 CDRLLIMGCLEELQTLGKAEANEVMLDIQKE 269 Nitrosomonas europaea
WP_010942626 238 CDFILLSAFAEQTTEIPGEMVRDIIGDLDFE 268 Geobacter sulfurreducens
WP_004512924 238 CDFLLLSAFVEEKKVICTDLVKEVIGEIESE 268 Geobacter metallireducens
WP_011366894 238 CDYVLLDAYAAGRRSINSAELQDLLAELDFE 268 Desulfovibrio alaskensis
WP_011176619 238 GSYVLLDAYAAGRRSISLPEMLDLLHSMDFD 268 Desulfovibrio vulgaris
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap