Conserved Protein Domain Family
EpsL

?
TIGR03014: EpsL 
exopolysaccharide biosynthesis operon protein EpsL
The epsL gene is described as a component of the methanolan exopolysaccharide biosynthesis operon in Methylobacillus sp strain 12S, although no other information regarding its possible function is suggested. Homologs of this gene are found in several other exopolysaccharide operons in a small number of species. These operons contain a subset of the methanolan operon genes by homology and synteny, including the epsH gene which is proposed to act as an "exosortase" directing proteins with a C-terminal tag (PEP-CTERM) to the exopolysaccharide layer. Each of the genomes in which these genes and epsL are found also encode genes with these C-terminal tags.
Statistics
?
PSSM-Id: 132059
View PSSM: TIGR03014
Aligned: 6 rows
Threshold Bit Score: 523.584
Threshold Setting Gi: 499631574
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC55133      16 SADDKDVVNFTLSHAITYDDNLFKLDRSESPTATFGKSQRWEMINATTYGVSINKPYSLQRFKFDVNQTSYRYQNYNFLN 95  Methylobacillus...
Q1GZP1        30 CALEGDVLKPYASLTYSYDDNLRRFASKQLAQMSTGSSDTSDTMLVKSAGIVLDHTISRQKMYVDFRLNKSTFNKNSELD 109 Methylobacillus...
WP_011379602  18 RMVPDKTFSVTAGTTFTYDSNVFRLSPLVNPIALTGQPRRADQIIITSATLGFNKRYSMQRFEVTGTLVDNRYMNFDFLD 97  Nitrosospira mu...
WP_011482808  81 YADELDTLQFQAGQSVQHDSNVFRLSDSADTQALLGTSDRSDTIAVTTAGFKVNKPYGLQRFEVAANVEKHNYRNFSNLD 160 Polaromonas sp....
WP_011312308  42 LAAEGDTFSPFVSYTRYYDSNLYRLDDNESSLV----PDKSDQYNVLTAGLNVDWRPGRQQVLAKASKSLVRFSRYDHLD 117 Thiobacillus de...
WP_011397246  24 QGKVGDAWEFSAGSLLRHEDNLFRSTSGNES---------NEQIVSAFAAVSGEQSISRQNLKLDARFSDHRYQHYDYLD 94  Hahella chejuensis
BAC55133      96 FDGTNYDIQWNWSLTPYLKGNIVFDRQQLPNTFANITSI-NPLT-TNTRTVKSNRFDFDWSPQGNWHLLGGVTDLTVTTD 173 Methylobacillus...
Q1GZP1       110 NDGRDVIARWDWELGNRLEGKVEFFHKKALVPFSEFQPLqGTMLsLNTRTQDRRLLEARWMLHPRWRVRGAFIYSEMEYG 189 Methylobacillus...
WP_011379602  98 FLGKNYNAAWHWYVTPYLHGRLTSRHSEALNNFANLSGF-LNGTnRNLRTLDNYHFDGVLELNRAWHLIGGLDHSIMKNS 176 Nitrosospira mu...
WP_011482808 161 FTAFNYGAAWRWSFTPALHGNLTTDRREYVDTTADVQ----TTGqLNRRTNRSTVFDAEYELDGAWRVLGGVFERTSTSS 236 Polaromonas sp....
WP_011312308 118 YDGSDYQLRWNWRLGNHLSGGIGGTEKVTQSNLGNQ----GGVPvNNEVTLRRGFADGAWQFHPRWSVGAGAATVESTNS 193 Thiobacillus de...
WP_011397246  95 YTAWEAEAAWDWLATSRLQGVLGADYNESINSFADFSG-----TeQNIRTRRRYYLDADWRVAGRWKLLAGGAHYQQENS 169 Hahella chejuensis
BAC55133     174 nsspTQNNIDFSFEQTSARAGIRYDLPSGSNLEYASSTANGKYGQS--TLNEVLFtDQGYEEKRQEFKFNWVLSGKSKLN 251 Methylobacillus...
Q1GZP1       190 ----AEAQRAANLKEDIQEIGFDYLSPTKSIIGVLYRNTKGSKPQQ--AFQGSFI-SNDYDQNELKLNVDWAVTGKSRLQ 262 Methylobacillus...
WP_011379602 177 ----RLTIQDFNNKVTSVEGGIRYVSSSGGSLTYRVRSGRGEFINRpaPLPEFLF-DTRFDEMEHDLRMHWPVTVKTSIE 251 Nitrosospira mu...
WP_011482808 237 ----QPFTFEGDYKIRGAEAGVRHVWSSGTSLAYRFKNGEGEYPGR--TLSAVS--ASDFTDREHELRLDWAPTGKTTVK 308 Polaromonas sp....
WP_011312308 194 ----VLTLL--DYEEDSVHATLGYKTPKGSKLSGQLRRAEGEYPNR--PVSSTL--DREYTQTEYNLLGDWTLTGKLIAH 263 Thiobacillus de...
WP_011397246 170 ----SLYRVEGDYQSDSLELGVGYEAPSGSHLSISLRKTDGDYANR--VISTTDRvDSGFEQTLAEMRFLWIFSGKSKVR 243 Hahella chejuensis
BAC55133     252 MSATYLDRKNDNFSQRDVSGWIGAVNYSWDVTGKTRINFIASTDLFPTQAI---------------SYTYVRQNLIAIRP 316 Methylobacillus...
Q1GZP1       263 FLGGLVDRQHEQLSQRDFRGVNARGNFNWMTSGKTNLNAAVWRENNAQSFV---------------TTSYTLNRGTSLTA 327 Methylobacillus...
WP_011379602 252 GRIGYLDRKHAHFSQRDFAGFVGDLNISWMPTSKVQVMGGWSRQLSNYQTApfafqh---siferfSSSYIATNRFSIAP 328 Nitrosospira mu...
WP_011482808 309 ARLSHFDRAHDGLSVRDFSGVTGQVDATWAVTGKTSITGGLARELGSYQTT---------------TSSYYQGLRFFIAP 373 Polaromonas sp....
WP_011312308 264 GKIGYVQREHDTRAQRDFSGVAGRLSADYMLTGKTTLNAAIYREVANSDRD---------------DATYQINTGTSLGA 328 Thiobacillus de...
WP_011397246 244 GSLGYVEREHYHYGERDYQGAIGGLSLDYQWTGSTSLSAAIEQSLASYQSSpatdidkilgggafyNSSYYRRRLVSIGP 323 Hahella chejuensis
BAC55133     317 TWSVTSKVLVRGDLTVRERAFEG----FAPVPPaedRHDRTRVASISATWEPRRFVSLGVMLKREVRDSNLINDDYVSNS 392 Methylobacillus...
Q1GZP1       328 NLQATGKIAVQGVLKYEKRDFEGd---QIFGQF---RSDKDKSFMLSLMYNPVTSFRITTSFIHSDRESTSDMFEFRSNS 401 Methylobacillus...
WP_011379602 329 TWQITEKTALRVRYDYVLSDFHG----AVVPLPtesRSDQMHSGLVALDWRPLNTLYLSAAFHRDHRSSNHRGFGFDSTA 404 Nitrosospira mu...
WP_011482808 374 TWKPTEKTAVRLRYDHGVRDFRG----PLPGFMatdREDTTRLASLILEWQPVRALKLMATAQRDRRTSNAPGFDYTSNV 449 Polaromonas sp....
WP_011312308 329 AWRATSKITVRGNAAFENRQFEGdpggPLVGDQ---RDDDTVSGSLSVGYSPIEAATIELGVQAGKRDSNITGYGYDFHA 405 Thiobacillus de...
WP_011397246 324 LWRYSAKVSLHARWRYEERDYEGg---LLTGPPa--REDRLQTLVLGGDWSPASYVLISAALQREKRASNQANADFNSDN 398 Hahella chejuensis
BAC55133     393 AMINAGLTF 401 Methylobacillus sp. 12S
Q1GZP1       402 VSVTGQYEF 410 Methylobacillus flagellatus KT
WP_011379602 405 GSVSATLNF 413 Nitrosospira multiformis
WP_011482808 450 FGISALASF 458 Polaromonas sp. JS666
WP_011312308 406 VFLSVRGDF 414 Thiobacillus denitrificans
WP_011397246 399 ATLSLTFTF 407 Hahella chejuensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap