Conserved Protein Domain Family
pepcterm_CAAX

?
TIGR03008: pepcterm_CAAX 
CAAX prenyl protease-related protein
The CAAX prenyl protease, in eukaryotes, catalyzes three covalent modifications, including cleavage and acylation, at the C-terminus of certain proteins in a process connected to protein sorting. This family describes a bacterial protein family homologous to one domain of the CAAX-processing enzyme. Members of this protein family are found in genomes that carry a predicted protein sorting system, PEP-CTERM/exosortase, usually in the vicinity of the EpsH homolog that is the hallmark of the system. The function of this protein is unknown, but it may relate to protein motification. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 163100
View PSSM: TIGR03008
Aligned: 6 rows
Threshold Bit Score: 192.309
Threshold Setting Gi: 499359742
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010942635  19 AAPRILPFASLMTLIGVEEVLRAMTTRGIVPFPPGWF---LYlyPVRIIIAGAVLAFCLKRCDELHLSD-L-----RrPL 89  Geobacter sulfu...
WP_011366885  17 ILPRILPFCCYMVFIAAREVSVLFSGMSDKLTDTVSF---IY--PVQIAIVVAALCYAVPRCPELSLRD-VglsgsR-GR 89  Desulfovibrio a...
WP_011176734 192 IAWRVAPFAAYMAFVLVVEAASMLGISSTTLATYGDFaggLY--PVKALCVGLVLAVCLPRCTELRFAK-A-----D-LR 262 Desulfovibrio v...
WP_011365908  29 TLAHILPFAVFMSFIAIEGLLPWLDKDGVIALQPESP---LYlyPLKTMVVGSLLLYFRKHYHEISIKQiV-----R-PS 99  Geobacter metal...
WP_011312309   4 IFVRSLPFGLYIGLLVLEGVLRDYATG----FDVRW----LY--PIKAGIVALALVVLWRHYAELHKYG-L-----R-SK 66  Thiobacillus de...
WP_011048051 349 AAALIAPFIVFMLSGLLVQSLWQAPAQG-------------Y--PLQAALMAAVLWLFRKPLLALDWR--L-----D-PV 405 Ruegeria pomeroyi
WP_010942635  90 HAAASVATGFAVYVLWVGMDWLLPFQSPP-PGFDPTgIDNDAL-RMSMIVFRLLGAALIIPVLEELFWRSFLLRYLIDKE 167 Geobacter sulfu...
WP_011366885  90 NTLFSAATGVAVFAIWIHLDLPWARIGTP-AGFSPD-IAEPGLpRNALLAVRLAGATLVVPVMEELFWRSFLIRYIRKPD 167 Desulfovibrio a...
WP_011176734 263 GLPFAIVVGVAVFAAWLALDVPWARMGEP-APFAHEaWGDAG--RPALLTIRFIGATLLVPLAEELFWRSFLLRHLQGGD 339 Desulfovibrio v...
WP_011365908 100 IAISAILAGIIVFMLWIQMDWLLPFQKPA-PGYNPNlIPNDIH-RIVLIAFRLAGASIVVPVMEEIFWRSYIARMIINQD 177 Geobacter metal...
WP_011312309  67 HVLLSLAVGIVVLVLWVNLDAGWMLLGEAgEGYDPR--GAEGRiDWLLVAFRIAGAALVVPIMEELFWRSFLQRWLQQSD 144 Thiobacillus de...
WP_011048051 406 ALLGGAVVGVG---------WILSFRGGP-APEGVSqLTGAALtGWVLC--RVLGTTLLVPVIEEGFFRGYLLQLL---- 469 Ruegeria pomeroyi
WP_010942635 168 FETVPIGKLTWPAFFFSTIL---FGLEHHYIVAGIMAGIAYTLLLRFTGSIVLCILAHAVTNLALGLHVINRQAWHFW 242 Geobacter sulfurr...
WP_011366885 168 FTSVPAGSLHWPSFCAVALL---FGLEHHLVVAGTIAGIAYNIVLIRTGSIMQCVLSHAVTNGMLGVWVILTGSWSFW 242 Desulfovibrio ala...
WP_011176734 340 FRTVPLTRFHATSFIAVTIL---FGLEHNLIVAGMAAGAAYNLVALRTGSVMCCVVAHAVTNGLLGLWVVATGAWTLW 414 Desulfovibrio vul...
WP_011365908 178 FESVPVGTFSWASFLGTVLL---FGLEHQFIIAGLMAGAIYHALLCRTKSIAACITAHSVTNLLLGIFVLKSGAWRFW 252 Geobacter metalli...
WP_011312309 145 FLALDPGRVGVKALLIASAL---FAVEHIQWFAGLIAGLAYGWLYIHTRNLWAPVVAHATTNGLLGAYVVTTEQWRFW 219 Thiobacillus deni...
WP_011048051 470 -----GGRSAWQTALAVGVTslaFALLHGRVIEAGLAGLIFAGIALRRGRLGDAILAHAVANGLIALTALLTGDWSLI 542 Ruegeria pomeroyi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap