Conserved Protein Domain Family
ectoine_ehuA

?
TIGR03005: ectoine_ehuA 
ectoine/hydroxyectoine ABC transporter, ATP-binding protein
Members of this family are the ATP-binding protein of a conserved four gene ABC transporter operon found next to ectoine unilization operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This family shows strong sequence similiarity to a number of amino acid ABC transporter ATP-binding proteins.
Statistics
?
PSSM-Id: 132050
View PSSM: TIGR03005
Aligned: 4 rows
Threshold Bit Score: 428.094
Threshold Setting Gi: 493354769
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ERT17060      35 VSFRSVTK-RYGNFTVLDGLELDVSAGEKVAIIG---PSGSGKSTLLRVLMTLEGIDEGSILVEGESLTHMQgRNGKLVP 110 Pseudomonas put...
WP_003525885   6 IRIDNIVK-RYGPLTVLDGLSMEVMPGEKLALIG---PSGSGKTTILRILMTLETISDGFIQVDGEQLYHMK-KAGSLVP 80  Sinorhizobium m...
WP_010914602  20 VRTHHQGRcHFEELRCLQGAGRLVDAGHAARKAGadrPLGSGKTTILRILMTLERIDGGHIQIEGEQLYHME-RNGQLLP 98  Mesorhizobium loti
WP_006311385  10 IEFSDVTK-RFGILTVLDQFNFSVAKGEKVTLIG---PSGSGKSTVLRILMTLEPFQEGQLKL-ADISYHQPgGKGPF-Q 83  Agrobacterium
ERT17060     111 ADAKHVRAVRGKIGMVFQGFNLFPHRTALQNVTEAPVHVLGVKPAEARDRAVQLLEMVGLGAKLDHYPSQLSGGQQQRVA 190 Pseudomonas put...
WP_003525885  81 ADERHLHKMREKIGMVFQHFNLFPHKCVLDNVTLAPMLTKGMARAQAEKRAMELLDMVGLADKAKSMPAQLSGGQKQRVA 160 Sinorhizobium m...
WP_010914602  99 ADERHLARMRQKIGMVFQLFNLFPHKSVIDNVTLAPMLTKGMPRAAAEKRAMELLDMVGMADKAKAMPAQLSGGQKQRVA 178 Mesorhizobium loti
WP_006311385  84 ASEKHLRQIRNHVGMVFQSFNLFPHMTVLRNIVEAPVRVLGIARAEAEARAIELLNMVGLADKKDHFPVQLSGGQQQRVA 163 Agrobacterium
ERT17060     191 IARALAMRPKVMLFDEVTSALDPELCGEVLNVIRRLGSEHKLTMLMVTHQMGFAREFADRVCFFYKGRIHEQGAPGQLFE 270 Pseudomonas put...
WP_003525885 161 IARALALSPKIMLFDEVTSALDPELVEEVLNVMRKLASETDMTMLLVTHEMGFAHDFADRVLFFDRGKIVEEGKPEDIFR 240 Sinorhizobium m...
WP_010914602 179 IARALALQPKIMLFDEVTSALDPELVEEVLNVLWRLCAETDMTMLLVTHEMGFAHDFADRVLFFDRGKIVEEGKPDEIFR 258 Mesorhizobium loti
WP_006311385 164 IARSLAMRPRVLLFDEPTSALDPQLVGEVLSVIRDLAHEHDLTMLLVTHEMRFAREVSDRVCFFDKGRICEQGKPDEIFG 243 Agrobacterium
ERT17060     271 TPQEERTRSFLSAVRE 286 Pseudomonas putida SJ3
WP_003525885 241 HPKQERTQTFLRKIIA 256 Sinorhizobium meliloti
WP_010914602 259 NPKQERTQGFLKKIIA 274 Mesorhizobium loti
WP_006311385 244 QPKEERTREFLSSVLR 259 Agrobacterium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap