Conserved Protein Domain Family
ectoine_ehuC

?
TIGR03004: ectoine_ehuC 
ectoine/hydroxyectoine ABC transporter, permease protein EhuC
Members of this family are presumed to act as permease subunits of ectoine ABC transporters. Operons containing this gene also contain the other genes of the ABC transporter and typically are found next to either ectoine utilization or ectoine biosynthesis operons. Permease subunits EhuC and EhuD are homologous.
Statistics
?
PSSM-Id: 132049
View PSSM: TIGR03004
Aligned: 3 rows
Threshold Bit Score: 296.76
Threshold Setting Gi: 489621449
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010955135   2 ADLLPLMLQGAWVTLQITFFGSLLAIVAATLAALGKMSTWRPLRWFCVVYIEIFRGTSLLVQLFWLFFVLPLppFNLELS 81  Pseudomonas putida
WP_010974128   4 TAYLPMLWQGAVVTMTITLAALVVGTVLAFFFGILRVEGGPILSTVALCYTEVFRGTSLLVQLFWFYYALPL--IGLSFD 81  Agrobacterium f...
WP_003525889   5 SGYIGLILQGAWVTVQLTLMGSALAVVVAFAAGLGRLSRFMAVRALATTYIEFFRGTSIFVQLFWVYFVLPF--AGITLT 82  Sinorhizobium m...
WP_010955135  82 PYTVAIVGLGLHIGAYGAEIMRGAINSVAKGQYEACTALNFRPFTRFRRIILPQALLAAMGPGTNLLIELLKNTSLVSLI 161 Pseudomonas putida
WP_010974128  82 PVTTGVMVLAAHAGGYGAEIVRGALSSVSVQQLEAARALNFTRMQTLFRISLPQAVVEMMPAFGNLAIETLKLSSLVSLI 161 Agrobacterium f...
WP_003525889  83 PLQAGVLALGLNVGAYGAEVVRGAVKAIGREQREACIALNLTRFQAMRHIVLPQALPLMLPTFGNNAIELLKGTAVVSLI 162 Sinorhizobium m...
WP_010955135 162 TLADLSFRARQLDQATFETLKVFALALLMYFVMAQAINLAMRRLERHLARGRVQGS 217 Pseudomonas putida
WP_010974128 162 SIADLTFAAQSIRNLTLDSTSIYSITLLCYFAMSLILMVIIRVIEHVVRRGNVFPR 217 Agrobacterium fabrum
WP_003525889 163 SLSDMTFQAQVVRAQTGSTLIPFATILLLYFVMAWLISLGMRWLERRVSRGLDGVR 218 Sinorhizobium meliloti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap