Conserved Protein Domain Family
ectoine_ehuD

?
TIGR03003: ectoine_ehuD 
ectoine/hydroxyectoine ABC transporter, permease protein EhuD
Members of this family are presumed to act as permease subunits of ectoine ABC transporters. Operons containing this gene also contain the other genes of the ABC transporter and typically are found next to either ectoine utilization or ectoine biosynthesis operons.
Statistics
?
PSSM-Id: 132048
View PSSM: TIGR03003
Aligned: 3 rows
Threshold Bit Score: 297.535
Threshold Setting Gi: 499281067
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010974127   5 YEWDTTTwityttSILPIILIGLTVTLKAAAAGFAIALVLGLVFALLRRSRVKLISWPTAVVVEFLRDTPLLVQLFFLYY 84  Agrobacterium f...
WP_010955134   4 FDWNYAI------QLLPELFRAALNTIGVTLLGFAIAIVLGLFLAIGRRSARIWISWPIGGVIEFIRSTPLLIQVYFLYY 77  Pseudomonas putida
WP_003525891   3 WDWEFVR------QIMPTLIEGLKITILATALGSVVAAVIGLVFAILRMTAPTPIARVTSFAVEFIRGTPLLVQLYFIFY 76  Sinorhizobium m...
WP_010974127  85 VLPEFGIVLPAFLTGALALGLQYAAYTSEVYRGGMEAVHHGQWEAATALNLTRMQTYRDIIIPQAIPRIVPAMGNYLVAM 164 Agrobacterium f...
WP_010955134  78 VLPNYGVSLTAMQVGVLGIGLHYACYLAEVYRSGLDAVPRGQWEAVTALNMSPSLAYRNIILPQALRPILPPVGNYLVAM 157 Pseudomonas putida
WP_003525891  77 VLPDIGIRLPALVAGVIGLGIHYGTYAAEVYRAGIENVPRGQWEAAKATNLTARQTWIHVILPQAIPPMIPALANYLIAM 156 Sinorhizobium m...
WP_010974127 165 IKETPVLSVVTVLEMMGLANMIGERTFEYLVPLTLVGLIFLLLTIICSAGLSRLQRAL 222 Agrobacterium fabrum
WP_010955134 158 LKDTPVLSAITVVEIMQQAKNIGSETFRYLEPITMVGVFFLALSIVLAYLVRRVEARL 215 Pseudomonas putida
WP_003525891 157 FKETPLLSAITVLELMNQAKSIANSNYRYIEPMTLVGVFFLIMSLISVFFLRWLEARY 214 Sinorhizobium meliloti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap