Conserved Protein Domain Family
Sig-70_X6

?
TIGR02999: Sig-70_X6 
RNA polymerase sigma factor, TIGR02999 family
This group of sigma factors are members of the sigma-70 family (TIGR02937) and are found in a variety of species including Rhodopirellula baltica which encodes a paralogous group of five.
Statistics
?
PSSM-Id: 132044
View PSSM: TIGR02999
Aligned: 14 rows
Threshold Bit Score: 190.607
Threshold Setting Gi: 489582897
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011042630   8 DVPVTELLTQWQNGDE--------------------TAYDELFIQCYQQFRHQIRKSKIQNLNNQQT----------Nvn 57  Colwellia psych...
WP_011123671   1 MAKVTQIINQIQSGNA--------------------AASD-LLPLVYEEMRRLARHKMQNEAVGQTL----------Q-- 47  Rhodopirellula ...
WP_011123524   2 MSSITQILQSSQNGDA--------------------AKTDQMFSFLYDDLRRMAGRFLQSEPRRERL----------S-- 49  Rhodopirellula ...
WP_011120523  13 ETEVSMLLQQVKDGDE--------------------EAREKLFVTLQSELRDMAGALMRGERPDHTL----------Q-- 60  Rhodopirellula ...
WP_011646509   2 SRAIRKAVPDQAQRDQ--------------------SCRHKLSAEAYDLLRAIASRQLRGQRPGATL----------N-- 49  Hyphomonas nept...
WP_011646640   6 DISAKQLLDAWRGGDL--------------------AARDQLFTQLYSELRQISAGLIRSER-NLSL----------S-- 52  Hyphomonas nept...
WP_011122648   9 MGDVTELLCQVRSGDA--------------------KASEGLLRAVYQELRSIAESQFAVEHRERTL----------Q-- 56  Rhodopirellula ...
WP_011149080   5 STSLTHIIQQWQAGDK--------------------EAESQLYQFAYLQLRKIAQQERERNAEKYGLenevladsvnS-- 62  Vibrio vulnificus
WP_011555075   1 MSELTELLDHARKGEQ--------------------GARDALMAAAYQELRDMVQRAMSDAASTPSL----------Q-- 48  Myxococcus xanthus
WP_011647138  25 SIPLVRITASVGRGTAlrrvpflmydqgserppevlAAADRLVPALWEDLRRVARRERRRVGAGQTL----------Q-- 92  Hyphomonas nept...
WP_011042630  58 qvsvcidsTTDIINHLYPRL-G-K-VTSAKLDNRADFYRLIGKVVYSIMKDQSRSKNAQKN-----TLPQEEKQPEYDCN 129 Colwellia psych...
WP_011123671  48 --------PTALVHEAYMRL-VgT-EDHPQWDSRGHFFTAAAEAMRRILIENARRRQSLKRggdrkRFEIAEDDAIIHFD 117 Rhodopirellula ...
WP_011123524  50 --------SSSLVHQAYVRM-V-D-QDHVDWQGKTHFFAIGATVMRRILVDHARRTQAQKRgggwiRRQLDD-EVTFLLD 117 Rhodopirellula ...
WP_011120523  61 --------ATALVNEACVRL-L-DtEALKNVSDRRYMFGMANRAMRQILIDHARRRRTNKRggdyqRASLDVVLDNFEAN 130 Rhodopirellula ...
WP_011646509  50 --------TTLVVHEAWMKL-S-Y-DENRQFVDEDHFLATASRAMRQILVDHVRRKLAEKRgagavHVPIEG-QQVAEPD 117 Hyphomonas nept...
WP_011646640  53 --------TGDLVNEAVIRL-M-R-VDQIEWADKVHFLALAARAMRRVLIDHARKKRSDKRhh--qKVTLISRLSDGNAD 119 Hyphomonas nept...
WP_011122648  57 --------PTALVNEAYLRLaS-G-GRLQKFDSRGHFYAAAAEAMRRILIDAARARGSRKRgghcrRLALGEVADDVTPA 126 Rhodopirellula ...
WP_011149080  63 --------TTALLHDAYLKL-S-T-SDMSEISGKRDFFLMAAKVMRQILIDNARSLQAQKR-------QQVTQLPSEHQE 124 Vibrio vulnificus
WP_011555075  49 --------PAVLVKEAWLRL-F-S-AGAP-VEARRHFFSAAAQAMRRVMVDRVRLRRAQVRearleRVSLGDVEADVPAG 116 Myxococcus xanthus
WP_011647138  93 --------TTALVSETWLKL-----RRKENFMDDQHFLRAAALAMRSVLIDHARARLTAKRgagkiDPLTDDIEPFWESD 159 Hyphomonas nept...
WP_011042630 130 IAETMCDLERVYNALVQEKPRAAELLQLNVFAGLNAKKIADMYNISLRTVQNELKFAHAWYHSHFN 195 Colwellia psychrerythraea
WP_011123671 118 NAEELLDLNDALTKFERSEPEIAKLVELRYFAGLSVDESAEALGISPRTVKRNWAFARAWLGRELN 183 Rhodopirellula baltica
WP_011123524 118 QDDDVVALDELLLQLASLSPRQARVVELRFFGGLGMKEIAAELNLGLRTVEKEWAMARAWMRRELR 183 Rhodopirellula baltica
WP_011120523 131 NRCQYEDLESALEGLEATSPRQREVVELRFFSGLTNEEVAKVLEISVATVERDWRLARAKLFDQLR 196 Rhodopirellula baltica
WP_011646509 118 AEVQLMDVEAALVRLAQHAPELEQIVECRFFAGYTVNETARILGRPVRSVERDWSRAKTYLAAYLK 183 Hyphomonas neptunium
WP_011646640 120 R-IEMDVLEKALIRLNVIDEEKAEIVELRYFGGMTLEEIAEIRGVSEATIKRNWRAARAWLLDCLN 184 Hyphomonas neptunium
WP_011122648 127 TDLL-LDLDDGLERLFKVDPDSAKLVELRVFAGLSITEAGELMKMSRSTAYRNWEFARTWFAVHWD 191 Rhodopirellula baltica
WP_011149080 125 KFEQLIIMDKALDNFSVRYPRQSNALKLKYLMGMKNQEISELLECSASLIEKDLKFSRSWLQSRMA 190 Vibrio vulnificus
WP_011555075 117 LSLEVLELDRALSELDTFQPRLARMLELRYFVGLDLLDTAAVLSVSPVTVKRDWAYVREWLLTRLG 182 Myxococcus xanthus
WP_011647138 160 --ERLLELDDALTRLSKLNPRLAEVVELRFFGGYTEVQAADILGVTDRTIRRDWIKARAWLFRELS 223 Hyphomonas neptunium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap