Conserved Protein Domain Family
RraA_entero

?
TIGR02998: RraA_entero 
regulator of ribonuclease activity A
This family includes a number of closely related sequences from certain enterobacteria. The E. coli member of this family has been characterized as a regulator of RNase E and its crystal structure has been analyzed. The broader subfamily which includes this equivalog, TIGR01935, was initially classified as a "hypothetical equivalog" with the name "regulator of ribonuclease activity A" based on the same evidence for this model. It now appears that, considering the second group of enterobacterial sequences within TIGR01935, the functional assignment is unsupported. THIS PROTEIN IS _NOT_ MenG, AKA S-adenosylmethionine: 2-demethylmenaquinone methyltransferase (EC 2.1.-.-). See the references characterizing this as a case of transitive annotation error. [Transcription, Degradation of RNA, Regulatory functions, Protein interactions]
Statistics
?
PSSM-Id: 132043
View PSSM: TIGR02998
Aligned: 4 rows
Threshold Bit Score: 273.22
Threshold Setting Gi: 76876560
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAI87782        1 MDYSTSDLCDHFADVVDVLEPMFINFGGRHSFGGRIKTVKCFENNELIRELLSQDGTDLVLLIDGGGSTRRALIDIELAE 80  Pseudoalteromo...
P67651          1 MKYDTSELCDIYQEDVNVVEPLFSNFGGRSSFGGQIITVKCFEDNGLLYDLLEQNGRGRVLLVDGGGSVRRALVDAELAR 80  Salmonella ent...
P44738          1 MFIDTSELCDLYAEQVDVVEPIFSSFGGVSNFYGKVTTVKCFESNGLIAEVLEENGEGRVLVIDGGGAVRRGLIDAELAQ 80  Haemophilus in...
tigr:CPS_4374   1 MQYNTSELCDFYADLIDVVDPIFCNYGGRSSFAGKVVTLKCFEHLGLINELVATYGTGKVLVIDGGGSTRRALIDLGIAQ 80  Colwellia psyc...
CAI87782       81 LALENNWQGIIVYGAVRHVDEIEELDLGIQAIASIPVAADSQGAGEDGIGVNFAGVSFFDDDFIYADSTGIVLSAEELEL 160 Pseudoalteromo...
P67651         81 LATQNEWEGLVIYGAVRQVDDLEELDIGIQAIAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGIILSEDPLDI 160 Salmonella ent...
P44738         81 LAVDNGWEGIIVYGAVRQIQQLENLDIGIHALAPIPVSADESSAGESDIPVNFGGVTFFPEDYIYADLTGIILSQEPLDL 160 Haemophilus in...
tigr:CPS_4374  81 CAANNGWEGIVCYGSVRDVDALDGVDIGIQALGAIPVGASEQNIGETDMAINFAGVTLLPDDYIYADNTGIILSPEALEI 160 Colwellia psyc...
CAI87782      161 E 161 Pseudoalteromonas haloplanktis TAC125
P67651        161 E 161 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
P44738        161 E 161 Haemophilus influenzae Rd KW20
tigr:CPS_4374 161 A 161 Colwellia psychrerythraea 34H
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap