Conserved Protein Domain Family
ectoine_ehuB

?
TIGR02995: ectoine_ehuB 
ectoine/hydroxyectoine ABC transporter solute-binding protein
Members of this family are the extracellular solute-binding proteins of ABC transporters that closely resemble amino acid transporters. The member from Sinorhizobium meliloti is involved in ectoine uptake, both for osmoprotection and for catabolism. All other members of the seed alignment are found associated with ectoine catabolic genes. [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 132040
View PSSM: TIGR02995
Aligned: 3 rows
Threshold Bit Score: 418.939
Threshold Setting Gi: 489621447
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010955136   7 LSAVAQrLTLACAIASIavSAHAATTLDSLKEQGSVRIGYANETPFAYTGTDGKVTGESPEIATAIFKQLGIKDVNGVLT 86  Pseudomonas putida
WP_010974129   3 MTKLAG-LSALALIIGV--TSASALTLEEVKKQGYIRAATANEVPYSYMQPDGTSAGIGPDVANAVLKSMGIEEVNWTVT 79  Agrobacterium f...
WP_003525887   7 MAMAAG-ATALMAVAAAtpAAADENKLEELKEQGFARIAIANEPPFTAVGADGKVSGAAPDVAREIFKRLGVADVVASIS 85  Sinorhizobium m...
WP_010955136  87 EWGSLIPGLRAGRFDAIAAGMYITPARCKQVLFTDPHYQLPDALLVPKGNPKELFSYEDVAKNPEVKLAIMAGTVELQYA 166 Pseudomonas putida
WP_010974129  80 PFGTLIPGLKARRFDFAAAEQNISPERCKQVAFTEPNSSYGEGLLVKKGNPKKLTTYADIAKDPALKVAVVSGANNVDFL 159 Agrobacterium f...
WP_003525887  86 EYGAMIPGLQAGRHDAITAGLFMKPERCAAVAYSQPILCDAEAFALKKGNPLGLKSYKDIADNPDAKIGAPGGGTEEKLA 165 Sinorhizobium m...
WP_010955136 167 RDSGVKDEQILQVPDTTAQLQAVRAkRADAAVGTQLTMKGLAAkgGD-SVEAMTDF-----KDDPSHiGYGALAFRPEDK 240 Pseudomonas putida
WP_010974129 160 RAVGVKEEQIVFIPANADAIPTVQS-RADAYAATELTVSELAK--GQaNVEQVKPFvdpvvKDAPVR-NYGGFAFRPEDK 235 Agrobacterium f...
WP_003525887 166 LEAGVPRDRVIVVPDGQSGLKMLQDgRIDVYSLPVLSINDLVSkaNDpNVEVLAPV-----EGAPV--YCDGAAFRKGDE 238 Sinorhizobium m...
WP_010955136 241 ELRDQVNAQLKKWLGSEEHLKTVAPFGFDKSNLTT---KTAAELC 282 Pseudomonas putida
WP_010974129 236 ELRDAFNTALVEFRKTDDYKKILAKYGLSEQSIAAaaeKKVADLC 280 Agrobacterium fabrum
WP_003525887 239 ALRDAFDVELAKLKESGEFAKIIEPYGFSAKAAMS---TTREKLC 280 Sinorhizobium meliloti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap