Conserved Protein Domain Family
ectoine_eutE

?
TIGR02994: ectoine_eutE 
ectoine utilization protein EutE
Members of this family, part of the succinylglutamate desuccinylase / aspartoacylase family (pfam04952), belong to ectoine utilization operons, as found in Sinorhizobium meliloti 1021 (where it the operon is known to be induced by ectoine), Mesorhizobium loti, Silicibacter pomeroyi, Agrobacterium tumefaciens, and Pseudomonas putida.
Statistics
?
PSSM-Id: 132039
View PSSM: TIGR02994
Aligned: 5 rows
Threshold Bit Score: 625.668
Threshold Setting Gi: 499358576
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010955131   2 KPSPIKPTIDFDQQGVSHGFLKLPYSRDDSAWGAIMIPITVMKNGIGPTVLLTGGNHGDEYEGPIALTKLANQLDIETVR 81  Pseudomonas putida
WP_014530717   7 RPSPISATVDFEANGVQHGFLRLPYSRDDSAWGSVMIPVTVVKNGEGPTALLTGGNHGDEYEGPIALFDLARKLDASDVE 86  Sinorhizobium m...
WP_010914610  21 RPSPIAPTVDFDRDGVQHGFLRLPYSRDDSAWGSVMIPICVIRNGKGPTALLSGGNHGDEYEGPLALYDLARALDPKQVS 100 Mesorhizobium loti
WP_010974130   7 RPSPITPTVDFDRKGVQHGHLRLPYSRDDSAWGSVMIPICVIANGDGPTALLTGANHGDEYEGPAALFELAYTLDPADVS 86  Agrobacterium f...
WP_011046886   2 QKNPISPTIPLDRDGVFHGFLKLPHSRDDSAWGSVMIPLTVIKNGAGPTALLTGANHGDEYEGPVALHELAATTSAEDVT 81  Ruegeria pomeroyi
WP_010955131  82 GRIIILPFMNYPAFKNASRTSPIDRGNLNRTFPGKADGTVTEKIADYIQRHLLPLADYVLDIHSGGKTLDFIPFAAVHIL 161 Pseudomonas putida
WP_014530717  87 GRVIIVPAMNYPAFQAQTRTSPIDKGNMNRSFPGRPDGTVTEKIADYFQRVLLPLADIVLDFHSGGKTLDFLPFCAAHIL 166 Sinorhizobium m...
WP_010914610 101 GTVIIVPAMNYPAFRAGTRTSPIDKGNMNRSFPGRPDGTVTEKIADYFQRELLPRADIVFDFHSGGKTLDFVPFCAAHTL 180 Mesorhizobium loti
WP_010974130  87 GRIIIVPALNYPAFRAGTRTSPIDRGNLNRSFPGRPDGSVTEKIADYVTRHLLPLADIVLDFHSGGRTLDFLPYAAAHEL 166 Agrobacterium f...
WP_011046886  82 GRLIIVPAFNYPAFRAGSRTSPIDRGNLNRSFPGRPDGTVTEKIADYFQRTLLPMADLAVDFHSGGKTLDFVPFAAAHIL 161 Ruegeria pomeroyi
WP_010955131 162 PDKLQQQKGERAMDAFAAPYSMKMLEIDSVGMFDTAVEEAGKIFVTTELGGGGTASSTTIKIAERGVRNFLVHAGAVMGD 241 Pseudomonas putida
WP_014530717 167 PDKAQEAKAFDFVRAFGAPYSMKMLEIDAVGMYDTAAEEMGKIFITTELGGGGSATARTASVAKRGVANVLRHAGILKGE 246 Sinorhizobium m...
WP_010914610 181 PDKVLEKKAFDAVAAFSAPFSMRMIEIDSVGMYDTAAEEMGKVFVSTELGGGGTSRAQTVRIARRGILNVLRHAGIVAGA 260 Mesorhizobium loti
WP_010974130 167 PDKTQEARCFEAVAAFAAPYSMKMLEIDAVGMLDTTAEELGKVFVTTELGGAGTASAKSIDIARKGTINLLRHAGILTGT 246 Agrobacterium f...
WP_011046886 162 EDKATQAACFAAMKAFNAPYSVELLEIDSAGMYDTAVEEMGKVLVTTELGGGGSSSARSNAIAKKGLRNVLIHAGILKGE 241 Ruegeria pomeroyi
WP_010955131 242 LDIAQdSIFLDMPDDNCFIASEHAGLIEYCFNLGDQVSKGDVIARVYDVTRTGVAPTEYKAQRDGLLACRHFPGLVQCGD 321 Pseudomonas putida
WP_014530717 247 IEAEP-TKWLDMPSEDCFAFAEDGGLVEFLIDLGGAVDRGAAIALIYPIGRTGVEPIEVRAKMDGVLVARHNPGLIKSGD 325 Sinorhizobium m...
WP_010914610 261 VEKGR-TQWLDMPSGDCFSFAEEDGMIETMVDLGEPVEKDAVLARIHSVGRTGIAPQEIRAKMSGMLAARHFPGLVKAGD 339 Mesorhizobium loti
WP_010974130 247 PVPAP-SRWLDMPSSDCFTFAEDDGLVAFVRDLGDAVTAGETIARVYPVGKTGLAPVEYRASISGVLAARHVPGLIKAGD 325 Agrobacterium f...
WP_011046886 242 MQLDE-TVNLTMPDDDCFVFSEGDGLFEMMIDLGAPVAKGDLLARVWPLDRTGQPPVEYRARRAGLVISRHFPGLIKSGD 320 Ruegeria pomeroyi
WP_010955131 322 TIAVLA 327 Pseudomonas putida
WP_014530717 326 CCAVLG 331 Sinorhizobium meliloti
WP_010914610 340 CAAVVA 345 Mesorhizobium loti
WP_010974130 326 CLSVIA 331 Agrobacterium fabrum
WP_011046886 321 CVAVVG 326 Ruegeria pomeroyi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap