Conserved Protein Domain Family
ectoine_eutC

?
TIGR02992: ectoine_eutC 
ectoine utilization protein EutC
Members of this protein family are EutA, a predicted arylmalonate decarboxylase found in a conserved ectoine utilization operon of species that include Sinorhizobium meliloti 1021 (where it is known to be induced by ectoine), Mesorhizobium loti, Silicibacter pomeroyi, Agrobacterium tumefaciens, and Pseudomonas putida. This family belongs to the ornithine cyclodeaminase/mu-crystallin family (pfam02423).
Statistics
?
PSSM-Id: 132037
View PSSM: TIGR02992
Aligned: 4 rows
Threshold Bit Score: 527.896
Threshold Setting Gi: 499282241
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011046888  18 IRILTEAELRDLVPLDLDAVDCVEQGFTTLAGGKVVMPPIMTLGVPDHNGEVCVKTAYVPGIDSFAMKMSPGFFDNPKIG 97  Ruegeria pomeroyi
WP_010974132   4 INILTEKDLRAVVKLDLSAIDCVERAFSALATEAVAMPPILRLDIPEFRGEVDVKTAYVPGFDGFAIKVSPGFFDNPKLG 83  Agrobacterium f...
WP_010955139   4 VLLLNQREIRECVTLDTDSIDVVENAFASLARGKVVMPSILRLDISEHNGEVDVKTAYLPDLENFAIKVSPGFFNNPGLG 83  Pseudomonas putida
WP_010975301   4 MKILTEAELRGIVPLDREAVACVEDAFRALATKAVAMPPILRLDIPEHRGEVDVKTAYVPGLDGFAIKISPGFFDNPKIG 83  Sinorhizobium m...
WP_011046888  98 LPSTTGLMVVFSSRTGILEALLLDNGYLTDVRTAAAGAVAARHLARAEASHVCIIGAGVQARMQLQAMTLVRDIESAAIW 177 Ruegeria pomeroyi
WP_010974132  84 LPSLNGLMILFSARTGLVDAMLLDNGYLTDVRTAAAGAVAARHLAREDASVAAIFGAGMQARLQLEALTLARPIRSARIW 163 Agrobacterium f...
WP_010955139  84 LPSLNGMMMLLSGRTGLLQALLLDNGYLTAVRTAAAGAVAARWLARQDSEEVALLGAGEQAELQLKALLLVRDIKRVRVW 163 Pseudomonas putida
WP_010975301  84 LPSTNGMMVLLSSKTGLVQALLLDNGYLTDVRTAAAGAVAARRLSREDSSVAAVFGAGMQARLQLEALALVRPIREARIW 163 Sinorhizobium m...
WP_011046888 178 ARDVAKAEAAAASLRQDLGIDVTVGTDIAQAVSPADIVITTTPASSPVIRAEWLQPGQLVIAMGSDQEHKGELEPACLTK 257 Ruegeria pomeroyi
WP_010974132 164 ARNHDRAEKLASDFAREHGIDVIAMTDPRAALQGADIIVTTTPAETPILLADWLEEGQHLTAMGSDAEHKNEIDPAVFAK 243 Agrobacterium f...
WP_010955139 164 ARSSAKAQQLALQLSSLYGLEATAAESVDEAMSSADIAVTCTPSNQPILHRRHLRPGLHITAMGADTEHKNEVAPEVIAA 243 Pseudomonas putida
WP_010975301 164 ARDAAKAEAAAIALGGKLGFAVKAETDPRAAITGADIIVTTTPSETPVLKAEWLEPGQHVTAMGSDAEHKNEIDPHAIAR 243 Sinorhizobium m...
WP_011046888 258 ADlYVPDSQAQCALKGELRSAIEAGLIAAGQSFAELGQVTSGQTPGRRSDRELIIADLTGTGVQDTAIATLAGNRADATG 337 Ruegeria pomeroyi
WP_010974132 244 AR-YVADRLSQTRILGELHHAIAAGRVAPDQPFPELGAIIAGKAQGRRSNDDITFADLTGTGVQDTAIANLAFTRAKDAG 322 Agrobacterium f...
WP_010955139 244 VDhYVADRVSQTATLGELHHAINAGVAQDLRVYAELGQVILGDRVGRLTPTDVTLCDLTGTGVQDTAIANLAFSRAISTG 323 Pseudomonas putida
WP_010975301 244 AT-YVADSLKQTRRLGELHHAIAAHLMSAEAEFPELGQVIAGLKPGRTRADEITIADLTGTGIQDTAIATLAFARANAAD 322 Sinorhizobium m...
WP_011046888 338 AGATFT 343 Ruegeria pomeroyi
WP_010974132 323 SGQIIE 328 Agrobacterium fabrum
WP_010955139 324 KGLLYN 329 Pseudomonas putida
WP_010975301 323 AGTTFE 328 Sinorhizobium meliloti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap