Conserved Protein Domain Family
ectoine_eutB

?
TIGR02991: ectoine_eutB 
ectoine utilization protein EutB
Members of this protein family are EutB, a predicted arylmalonate decarboxylase found in a conserved ectoine utilization operon of species that include Sinorhizobium meliloti 1021 (where it is known to be induced by ectoine), Mesorhizobium loti, Silicibacter pomeroyi, Agrobacterium tumefaciens, and Pseudomonas putida. Members of this family resemble threonine dehydratases.
Statistics
?
PSSM-Id: 132036
View PSSM: TIGR02991
Aligned: 4 rows
Threshold Bit Score: 483.586
Threshold Setting Gi: 499282240
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010975300   7 VTIDDIEVAARRISGRVLTTPLAMSGSLSELCGVPVGLKLEHHQTTGSFKLRGATNAVLSLSAGDRALGVIAASTGNHGR 86  Sinorhizobium m...
WP_010914607  28 VSLNDIRAARERIASKVEYTPTVLSSSLSERLGVPVHLKLEHRQTTGSFKLRGATNAVSSLSAEEKAGGVVAASTGNHGR 107 Mesorhizobium loti
WP_011046889   5 ITLQDSIRARARIAGRIRETPLVESPSLSSLSGRQVLLKLESRQITGSFKLRGATNAVLSLTDTQRAAGVVGVSTGNHGR 84  Ruegeria pomeroyi
KEY54043      20 VSLAAIERAATRLSGQVERTPLVRSEFLSERCGHPVHLKLETLQPIGAFKLRGAMNAILSLDDAVRRRGLVTASTGNHGR 99  Agrobacterium t...
WP_010975300  87 ALAHAAKAEGSVATICMSHLVPVNKVSEIRRLGANVRIVGNSQDEAQEEVERLVAENGLVMVPPFDHRAIVAGQGTLGLE 166 Sinorhizobium m...
WP_010914607 108 ALAHAAKLEGMRAVICMSRLVPQNKLDEIRRLGAEVHIVGNSQDDAQQEVERLVAQQGLVMLPPFDNPAIIAGQGTLGLE 187 Mesorhizobium loti
WP_011046889  85 GLAYAAAEAEVRCIICMSELVPQNKVDGIRSHGAEVRILGRSQDDAQQEVDRLVRD-GMTMLPPFDHPDIIAGQGTVALE 163 Ruegeria pomeroyi
KEY54043     100 AVAYAAAKLGIPATICMSALVPANKVEAIRMLGAEIRIVGRSQDDAQEEVERLTKNRGLTAIPPFDHADVVAGQGTIGLE 179 Agrobacterium t...
WP_010975300 167 VVAQMPDVAMVLVPVSGGGLAAGVAAAVKARRPATRVIGLTMERGAAMKASFAAGGPALVDEQPSLADSLGGGIGLDNRV 246 Sinorhizobium m...
WP_010914607 188 MIEQVPDAALVLVQLSGGGLASGVATAVKGIRPGTEVIGVSMARGAAMKASLDAGRPVLVEELPTLADSLGGGIGLDNRL 267 Mesorhizobium loti
WP_011046889 164 MLDQAPDLETVLVPLSGGGLISGVGMVLKAANPDIRVIGVSMERGAAMYECLQAGRPVQVAELPTLADSLGGGIGLDNAY 243 Ruegeria pomeroyi
KEY54043     180 VVEDMPELATILVPLSGGGLAGGIAVAVKALKPRARVIGISMERGAAMHASVKAGRPVSVCEEETLADSLGGGIGLANRV 259 Agrobacterium t...
WP_010975300 247 TFRMCRELLDDIILLTEAEIAAGMRHAYAEEREIVEGAGAVGISALLAGKIKdIDGPIAVIISGRNVDMDLHLRVMNG 324 Sinorhizobium mel...
WP_010914607 268 TFAMCRDLLDEIILLSEDEIAAGICHAYAQEREIVEGAGAVGIAALLAGKVK-AKGPMVVLLSGRNIDMNAHRRIICG 344 Mesorhizobium loti
WP_011046889 244 TFEMTKAFVDEVVLVSEAEIAAAIRHAYFEEREVIEGSGSVGIAALLAGKIG-NPGRCVSLVSGQNIAMDLHKRIIDG 320 Ruegeria pomeroyi
KEY54043     260 TFALCKTLLDEIVLVSEDEIATGICHASREEDLRVEGAGAVGFAAILAGKIA-VSGPAAIIVSGGNIDPAVHKTIIDG 336 Agrobacterium tum...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap