Conserved Protein Domain Family
ectoine_eutA

?
TIGR02990: ectoine_eutA 
ectoine utilization protein EutA
Members of this protein family are EutA, a predicted arylmalonate decarboxylase found in a conserved ectoine utilization operon of species that include Sinorhizobium meliloti 1021 (where it is known to be induced by ectoine), Mesorhizobium loti and Silicibacter pomeroyi. It is missing from two other species with the other ectoine transport and utilization genes: Pseudomonas putida and Agrobacterium tumefaciens.
Statistics
?
PSSM-Id: 132035
View PSSM: TIGR02990
Aligned: 3 rows
Threshold Bit Score: 411.263
Threshold Setting Gi: 505056265
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011046890  16 LDDRPVRKRIALVALATDHTSERDFARICDPDQVGVYTNRIAFENPTNKETLLKTGPRLTEAAARILPGEEVDVVAYCCT 95  Ruegeria pomeroyi
WP_010914606  16 LDDRPLDKRVGLIILATDHTSEPDFRRMVASERIGVHVARIPYANPTTPENLRKMQPALTAGAALILPDEKLDAICYSCT 95  Mesorhizobium loti
WP_015243367  16 LDDRPLDKRIGLVILATDHTTEVDFQRMVASDRIGVYVTRIPYANPVTPENLRAMQPSLTEAAALILPDETLDVVMYSCT 95  Sinorhizobium m...
WP_011046890  96 AASIVLGNDTVTRHLNAAKPGTPCVTPSSAAFDAFAALGVRRVSLLTPYSPDVTDEMAQYFAVHGPEVVNAACFGLTDDR 175 Ruegeria pomeroyi
WP_010914606  96 SASVVIGDAEIETAIQAAKPGVPVVTPPMAGVRGLNAFGVRRISILTPYTVETSRPMAAYFAARGFEIASFTCLGFEDDR 175 Mesorhizobium loti
WP_015243367  96 SASVVIGDREVAAAIKAAKPEAAVVTPTAASVQGLRALSANRISVLTPYTIETSRPMADYFAERGFAIDRFTCLGLTDDR 175 Sinorhizobium m...
WP_011046890 176 EMARISEDCIIEAALAAFDKDAEALFLSCTALRAATCAQRIEDRLGKPVVTSNQAMIWRCLRLAGIPDMVPGYGRLFHL 254 Ruegeria pomeroyi
WP_010914606 176 EMARIPPAALVDLARQVTDPQADALFVSCTALRGALAVTGMEQAIGRPVVTSNQATAWNCLRLCGDETPRPEFGQLMTL 254 Mesorhizobium loti
WP_015243367 176 EMARISPKEIVAFAKEAAAPASDALFISCTAVRAAGVIAEIEQAIGKPVVSSNYATAWACLRLCGDREARPQLGRLMEL 254 Sinorhizobium me...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap