Conserved Protein Domain Family
phageshock_pspE

?
TIGR02981: phageshock_pspE 
phage shock operon rhodanese PspE
Members of this very narrowly defined protein family are proteins active as rhodanese (EC 2.8.1.1) and found in the extended variants of the phage shock protein (psp operon) in Escherichia coli and a few closely related species. Note that the designation phage shock protein PspE has been applied, incorrectly, in many instances where the genome lacks the phage shock regulon entirely.
Statistics
?
PSSM-Id: 132026
View PSSM: TIGR02981
Aligned: 2 rows
Threshold Bit Score: 209.103
Threshold Setting Gi: 446395272
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_000473127   3 KKGLLALTLVFSLPVFAAEHWIDVRVPEQYQQEHVQGAINIPLKEVKERIATAVPDKNDTVKVYCNAGRQSGQAKDILSE 82  Escherichia coli
WP_023165352   3 KKGIFALALFIAMPLYAAEYWIDVRIPEQYQREHIQGAINIPLKEIKSHIETVVPDRNDTVKLYCNSGRQSGMAKQMLLD 82  Salmonella ente...
WP_000473127  83 MGYTHVENAGGLKDIAMPKVK 103 Escherichia coli
WP_023165352  83 MGYTHAMNMGGISRLDMPKVK 103 Salmonella enterica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap