Conserved Protein Domain Family
phageshock_pspC

?
TIGR02978: phageshock_pspC 
phage shock protein C
All members of this protein family are the phage shock protein PspC. These proteins contain a PspC domain, as do other members of the larger family of proteins described by pfam04024. The phage shock regulon is restricted to the Proteobacteria and somewhat sparsely distributed there. It is expressed, under positive control of a sigma-54-dependent transcription factor, PspF, which binds and is modulated by PspA. Stresses that induce the psp regulon include phage secretin overexpression, ethanol, heat shock, and protein export defects. [Cellular processes, Adaptations to atypical conditions]
Statistics
?
PSSM-Id: 132023
View PSSM: TIGR02978
Aligned: 19 rows
Threshold Bit Score: 152.019
Threshold Setting Gi: 499764083
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAI87103       4 KRELLRDPQRGKIAGVCAGLSDYFNMELWLVRIIFVSAVLLTGGPLFVVAYIAAWFILDKKePTSAYKTNStnygdpleV 83  Pseudoalteromon...
P23855         7 NKKLWRIPQQGMVRGVCAGIANYFDVPVKLVRILVVLSIFFGLALFTLVAYIILSFALDPM-PDNMAFGEQ--------- 76  Escherichia coli
CAH21506       7 SKKLYRVPEEGMIKGVCAGLAHYFDIPVRLVRVIMVLSLFFGLFVFTVAAYIILAFMLEPV-SAASVTNDN--------- 76  Yersinia pseudo...
WP_011093547   7 GKTLYRIPEEGMLKGVCAGLARYFDVPVKLLRIIVVLSMFFGLFFFTIVAYIILTFMLDPA-PAGMGFEDE--------- 76  Pectobacterium ...
WP_011648264  13 PKRFYRSRQDKVIAGVCGGIAERFGWEPVLVRILTVLATLFFMGPMAPIIYIVIWMITPRA-PIGYGSMSP--------D 83  Hyphomonas nept...
WP_011240903   5 RTKFYRDKAHGKILGVCSGLADYAGVDVTLVRVLTVIMTLVGGFPWIVVAYFVTAWLTEDK-PRALQEMDS--------D 75  Zymomonas mobilis
WP_011399174  11 NRNLYRDPDAGWIAGVCAGLAESYGQPVWLARIIMLSVFIFSGSLGVLL-YIAGVVLLAKR-PRNSYAPSH--------- 79  Hahella chejuensis
WP_011146805   6 RRKLYRIPEKGKIKGVCAGLAYYFDVPVRLIRAIAVLSLFFGLFGFVVVAYIVLVFVLDPA-PSEYTEEAH--------F 76  Photorhabdus lu...
WP_011413645   5 RTTLYRDKQNAKLMGVCSGIADYTGVNPLWVRLGFLV-LLFTIAPILLPAYFIAGLLLNKK-PPHLYVDQD--------- 73  Erythrobacter l...
WP_027182328  23 GRTLYR-ARDGKIMGVCKGLAEYFEVEPVWIRLFTILGALATGIWPALGIYILAGLLMKPK-PVMPVRDIH--------E 92  Desulfovibrio a...
CAI87103      84 KFKVWQKGEP-PRRALQDLKERLTRVDTRLQNIERYVTSTEFTVSREINKL 133 Pseudoalteromonas haloplanktis TAC125
P23855        77 --------LPsSSELLDEVDRELAASETRLREMERYVTSDTFTLRSRFRQL 119 Escherichia coli
CAH21506      77 -----DV--T-PRQLLDQLQHELAQGEQQLRQVERYVTSDTFGVRSRFRQL 119 Yersinia pseudotuberculosis IP 32953
WP_011093547  77 -----KAART-PSQLLDEADATLQASEQRLRNIERYVTSDTFGVQNRFRHL 121 Pectobacterium atrosepticum
WP_011648264  84 EDAFWRGVQDrPRATFGTIKYTFMDLDERLKNIERTVTSDEWRLRQEFRDL 134 Hyphomonas neptunium
WP_011240903  76 ETRFWQEVRTkPTVSLRNVKNRFRDINGRLAKVETYITSQDRRLAKEIDNL 126 Zymomonas mobilis
WP_011399174  80 GRPLFDYGES-ASDRARQLKERMRALEMRLQSMERYVTSNRFNVNKEFKNL 129 Hahella chejuensis
WP_011146805  77 ---------S-AQNLLNEIDYQLKSGEIRLRQMERYITSETFSVRSRFRQL 117 Photorhabdus luminescens
WP_011413645  74 ESKYWQRMRQnPKRTVREVRGKFRDIDRRLAEVETFYVSSNPRLNSEIERL 124 Erythrobacter litoralis
WP_027182328  93 GEFYSSYVSS-RKAALARLKEQFARLDRRIRRMEDAVTSRDFDWQRRFDDr 142 Desulfovibrio alaskensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap