Conserved Protein Domain Family
phageshock_pspB

?
TIGR02976: phageshock_pspB 
phage shock protein B
This model describes the PspB protein of the psp (phage shock protein) operon, as found in Escherichia coli and many related species. Expression of a phage protein called secretin protein IV, and a number of other stresses including ethanol, heat shock, and defects in protein secretion trigger sigma-54-dependent expression of the phage shock regulon. PspB is both a regulator and an effector protein of the phage shock response. [Cellular processes, Adaptations to atypical conditions]
Statistics
?
PSSM-Id: 132021
View PSSM: TIGR02976
Aligned: 11 rows
Threshold Bit Score: 46.214
Threshold Setting Gi: 499688236
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8ZE35            1 MSILFLAIPLTIFVLFvAPIWLWLHYNGRQQNGVQLSHQDMQRLSLLTEDARRMRERIQALEEILDTEHPNWRQS 75  Yersinia pestis
goetting:GOX0932  3 SSIFPFLVPITAIIAW-SVTSMVKHMTRQPDRAVSADPMLQAALTQAEAHATRLEERIDQLERILDEDIPGWRAR 76  Gluconobacter oxy...
P23854            1 MSALFLAIPLTIFVLFvLPIWLWLHYSNRSGRSE-LSQSEQQRLAQLADEAKRMRERIQALESILDAEHPNWRDR 74  Escherichia coli
Q87QH5            1 MSAFFLVGPVIVFLIFvAPLWLFLHYRSKRKTDSALSSQDLERLQVLSEKAEAMQSRVDTLERILDAESPTWRRK 75  Vibrio parahaemol...
Q8D8U0            1 MTTFMIAGPLIVFLIFvAPLWLFLHYRSQRKVGSGLSDIDLQKLESLSGQAEKLQSRIDTLERILDAENPNWRRR 75  Vibrio vulnificus
Q9KRG5            1 MSSFFIAVPLIVFCIFvAPLWLILHYRSKRKTGDGLSDEELQLLRTLSDKANRLQDRVETLERILDDETPNWRNR 75  Vibrio cholerae
Q8EG06            1 MDMDILMAPIIIFMIVvAPIWLVLHYRSKRQVSQGLTEEEFSQLNDLIAKADKMAARIETLEAILDSESPEWRGK 75  Shewanella oneide...
AAS97458         22 MMLWFVVLPAL----VaVLLLVLIARMFRSRGSESAATDDVRLLQELHSTMDRLERRVEALETLLADD---ARRd 89  Desulfovibrio vul...
WP_011413646      1 -MEEVIIIPAI----FiGLPWLILHYVTKWKTAATITGDDEALLEEMYNLAKRLDERMDTVERLVQHDHADFKPA 70  Erythrobacter lit...
WP_011444816      1 -MEDVVAIAAI----FlGLPWIIFHYITKWKTAATLTNGDEALLEELYQLARRLDERMDTVERLVAADNPDFKPS 70  Novosphingobium a...
WP_011368970      9 GMFWFMILPLIAIAVVlVLLLRLLRDR-RPGADADAATDEARMIQELYRGMNRMEQRVEALETLLLERDARSARR 82  Desulfovibrio ala...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap