Conserved Protein Domain Family
phageshock_pspG

?
TIGR02975: phageshock_pspG 
phage shock protein G
This protein previously was designated yjbO in E. coli. It is found only in genomes that have the phage shock operon (psp), but only rarely is encoded near other psp genes. The psp regulon is upregulated in response to a number of stress conditions, including ethanol, expression of the filamentous phage secretin protein IV and other secretins, and heat shock. [Cellular processes, Adaptations to atypical conditions]
Statistics
?
PSSM-Id: 132020
View PSSM: TIGR02975
Aligned: 5 rows
Threshold Bit Score: 54.3482
Threshold Setting Gi: 498321910
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
wugsc:SPA4061  2 LELLFVLGFFLMLMVTGVSLLGILAALVVATAVMFLGGMFALMIKLLPWLLLAVAVVWVIKAVK 65  Salmonella enterica subsp. ente...
CAG76559       2 LEIFFVIGFFIMLMLTGVSLLGVIAALFVASLFMLIGGLFTMAIKVLPWLILAVAAVWLWRKFS 65  Pectobacterium atrosepticum SCR...
CAH19613       2 LEIFFVIGFFMVLMVTGISLLGILAALLVAAVFMMLGGLFVMMIKLLPWLILAVVVAWIWRSMQ 65  Yersinia pseudotuberculosis IP ...
BAC95735       3 LELIFILVFAATLLVTGITMMTVFAATGIALVVMILLGMLGFVLKLLPWLIVIAVAIWFFKHVV 66  Vibrio vulnificus YJ016
WP_010636066   2 LEFIVLMLVLVGMALAGFTVLAMLLVSGVFVLFGALAGMFALIIKLAPWLLVLLVVCWFISSRR 65  Aeromonas
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap