Conserved Protein Domain Family
nitrate_rd_NapE

?
TIGR02973: nitrate_rd_NapE 
periplasmic nitrate reductase, NapE protein
NapE, homologous to TorE (TIGR02972), is a membrane protein of unknown function that is part of the periplasmic nitrate reductase system; it may be part of the enzyme complex. The periplasmic nitrate reductase allows for nitrate respiration in anaerobic conditions. [Energy metabolism, Anaerobic, Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 132018
View PSSM: TIGR02973
Aligned: 8 rows
Threshold Bit Score: 58.5558
Threshold Setting Gi: 27355317
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:ReutB_4761 13 KKEELRSFLFLTAVMVPVLSVITVAGYGFIVWMSQLISGPPT 54  Ralstonia eutropha JMP134
AAG04566       11 KGMEARLFLFLVICLFPLLSVALVGGFGFCVWMYQLLAGPPG 52  Pseudomonas aeruginosa PAO1
AAL45199       16 RTKELITFAVLAFGIWPVLAVGFVGAFGFIVWMFQIIYGPPG 57  Agrobacterium tumefaciens str. C58
AAC79440       17 RRRELLTFVVLAFGIWPVVAVGTVATYGFAVWAYQIVYGPPG 58  Pseudomonas sp. G-179
CAA86831       16 RRHELIVFFFLAAVIWPFLSVAFVGGYGFLIWMWQIVFGPPG 57  Rhodobacter sphaeroides
BAC52301       14 RRMEIFAFLFLTAVVMPVLAVGTVGSYGLGVWIYQMFAGPPG 55  Bradyrhizobium diazoefficiens USDA 110
CAE33290       10 KRQELNSFLLLAAVMAPVITGIIIVTYGFAVWFYQLLAGPPG 51  Bordetella bronchiseptica RB50
WP_011041898   11 KKHERNTFIFLAVFLAPILSVIIVAGFGFAVWISQIFFGPPS 52  Colwellia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap