Conserved Protein Domain Family
TMAO_torE

?
TIGR02972: TMAO_torE 
trimethylamine N-oxide reductase system, TorE protein
Members of this small, apparent transmembrane protein are designated TorE and occur in operons for the trimethylamine N-oxide (TMAO) reductase system. Members are closely related to the NapE protein of the related periplasmic nitrate reductase system. It may be that TorE is an integral membrane subunit of a complex with the reductase TorA. [Energy metabolism, Anaerobic]
Statistics
?
PSSM-Id: 132017
View PSSM: TIGR02972
Aligned: 4 rows
Threshold Bit Score: 72.1675
Threshold Setting Gi: 491564658
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_000808023 20 ESGEKRSLEWKSFLFITVVLFPILSVAFVGGYGFIVWMLQM-FvFGPPG 67  Vibrio cholerae
WP_011071462  9 SDKSSRSNELKALGFIIFILFPALTIAGISLYGFIIWMIQA-F-GGVVG 55  Shewanella oneidensis
WP_005422244  8 SDENKRSSEWKAFFFITVVLFPILSVGVVGAYGFSVWFMQMlF-FGMPG 55  Aliivibrio fischeri
WP_011042655 10 tgEKKKRKELKALGFIIVVLFPVLSVFAIGGYGLIIWLIQA-F-GGVIP 56  Colwellia psychrerythraea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap