Conserved Protein Domain Family
mam_aldehyde_ox

?
TIGR02969: mam_aldehyde_ox 
aldehyde oxidase
Members of this family are mammalian aldehyde oxidase (EC 1.2.3.1) isozymes, closely related to xanthine dehydrogenase/oxidase.
Statistics
?
PSSM-Id: 132014
View PSSM: TIGR02969
Aligned: 3 rows
Threshold Bit Score: 2895.48
Threshold Setting Gi: 20981678
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q06278    5 SELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYNPITKRIRHHPANACLIPICSLYGA 84   human
P80456    5 PELLFYVNGRKVVEKQVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYNRVTKKIRHYPVNACLTPICSLYGA 84   rabbit
Q9Z0U5    4 PQLLFYVNGQKVVENNVDPEMMLLPYLRKNLRLTGTKYGCGGGGCGACTVMISRYNPSTKSIRHHPVNACLTPICSLYGT 83   Norway rat
Q06278   85 AVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPGMVMSIYTLLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDACKTF 164  human
P80456   85 AVTTVEGIGSTTTRLHPVQERIAKFHGTQCGFCTPGMVMSMYALLRNHPEPTLDQLADALGGNLCRCTGYRPIIEAYKTF 164  rabbit
Q9Z0U5   84 AVTTVEGIGNTRTRLHPVQERIAKCHSTQCGFCTPGMVMSMYALLRNHPEPSLDQLTDALGGNLCRCTGYRPIIDACKTF 163  Norway rat
Q06278  165 CKTSGCCQSKENGVCCLDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQSQRTRVFGSERMMWF 244  human
P80456  165 CKTSDCCQNKENGFCCLDQGINGLPEVEEENQTRPNLFSEEEYLPLDPTQELIFPPELMTMAEKQPQRTRVFSGERMMWI 244  rabbit
Q9Z0U5  164 CRASGCCESKENGVCCLDQGINGSAEFQEGDETSPELFSEKEFQPLDPTQELIFPPELMRIAEKQPPKTRVFYSNRMTWI 243  Norway rat
Q06278  245 SPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHAYNGLTLGAGLSLAQVKDILADVVQ 324  human
P80456  245 SPVTLKALLEAKSTYPQAPVVMGNTSVGPGVKFKGIFHPVIISPDSIEELNVVSHTHSGLTLGAGLSLAQVKDILADVVQ 324  rabbit
Q9Z0U5  244 SPVTLEELVEAKFKYPGAPIVMGYTSVGPEVKFKGVFHPIIISPDRIEELSIINQTGDGLTLGAGLSLDQVKDILTDVVQ 323  Norway rat
Q06278  325 KLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNAD 404  human
P80456  325 KVPEENAQTYRALLKHLGTLAGSQIRNMASLGGHIISRHLDSDLNPLLAVGNCTLNVLSKEGERQIPLDEQFLSRCPEAD 404  rabbit
Q9Z0U5  324 KLPEETTQTYRALLKHLRTLAGSQIRNMASLGGHIVSRHLDSDLNPLLAVGNCTLNLLSKDGKRQIPLSEQFLRKCPDSD 403  Norway rat
Q06278  405 LKPQEILVSVNIPYSRKWEFVSAFRQAQRQENALAIVNSGMRVFFGEGDGIIRELCISYGGVGPATICAKNSCQKLIGRH 484  human
P80456  405 LKPQEILASVHIPYSRKWEFVLAFRQAQRKQNALAIVNSGMRVFFGEGDGIIRELAISYGGVGPTIICAKNSCQKLIGRS 484  rabbit
Q9Z0U5  404 LKPQEVLVSVNIPCSRKWEFVSAFRQAQRQQNALAIVNSGMRVLFREGGGVIKELSILYGGVGPTTIGAKNSCQKLIGRP 483  Norway rat
Q06278  485 WNEQMLDIACRLILNEVSLLGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPVHYPSLADKYESALEDLHSKHHCST 564  human
P80456  485 WNEEMLDTACRLILDEVSLPGSAPGGKVEFKRTLIISFLFKFYLEVSQILKRMAPGLSPHLADKYESALQDLHARYSWST 564  rabbit
Q9Z0U5  484 WNEEMLDTACRLVLDEVTLAGSAPGGKVEFKRTLIISFLFKFYLEVLQGLKREDPGHYPSLTNNYESALEDLHSKHHWRT 563  Norway rat
Q06278  565 LKYQNIGPKQHPEDPIGHPIMHLSGVKHATGEAIYCDDMPLVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVDIMTA 644  human
P80456  565 LKDQDVDARQLSQDPIGHPVMHLSGVKHATGEAIYLDDMPAVDQELFMAFVTSPRAHAKIVSTDLLEALSLPGVVDIVTA 644  rabbit
Q9Z0U5  564 LTHQNVDSMQLPQDPIGRPIMHLSGIKHATGEAIYCDDMPAVDRELFLTFVTSSRAHAKIVSIDLSEALSLPGVVDIITA 643  Norway rat
Q06278  645 EHLSDVNSfcffTEAEKFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEESIQHNSSFKPERKLE 724  human
P80456  645 EHLQDGNT----FYTEKLLAADEVLCVGQLVCAVIAESEVQAKQAAKQVKIVYEDLEPVILSIEEAIEQKSFFEPERKLE 720  rabbit
Q9Z0U5  644 DHLQDATT----FGTETLLATDKVHCVGQLVCAVIADSETRAKQAAKHVKVVYRDLEPLILTIEEAIQHKSFFESERKLE 719  Norway rat
Q06278  725 YGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKYIQDIVASTLKLPANKVMCHVRRVG 804  human
P80456  721 YGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSVLVVPKGEDQEMDVYASTQFPKYIQDMVAAVLKLPVNKVMCHVKRVG 800  rabbit
Q9Z0U5  720 CGNVDEAFKIADQILEGEIHIGGQEHFYMETQSMLVVPKGEDGEIDIYVSTQFPKHIQDIVAATLKLSVNKVMCHVRRVG 799  Norway rat
Q06278  805 GAFGGKVLKTGIIAAVTAFAANKHGRAVRCVLERGEDMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGASLDESL 884  human
P80456  801 GAFGGKVFKASIMAAIAAFAANKHGRAVRCILERGEDMLITGGRHPYLGKYKAGFMNDGRIVALDVEHYSNGGCSLDESL 880  rabbit
Q9Z0U5  800 GAFGGKVGKTSIMAAITAFAASKHGRAVRCTLERGEDMLITGGRHPYLGKYKVGFMRDGRIVALDVEHYCNGGSSLDESL 879  Norway rat
Q06278  885 FVIEMGLLKMDNAYKFPNLRCRGWACRTNLPSNTAFRGFGFPQAALITESCITEVAAKCGLSPEKVRIINMYKEIDQTPY 964  human
P80456  881 LVIEMGLLKMENAYKFPNLRCRGWACRTNLPSNTAFRGFGFPQAGLITECCITEVAAKCGLSPEKVRAINFYKEIDQTPY 960  rabbit
Q9Z0U5  880 WVIEMGLLKMDNAYKFPNLRCRGWACRTNLPSHTALRGFGFPQAGLVTEACVTEVAIRCGLSPEQVRTINMYKQIDNTHY 959  Norway rat
Q06278  965 KQEINAKNLIQCWRECMAMSSYSLRKVAVEKFNAENYWKKKGLAMVPLKFPVGLGSRAAGQAAALVHIYLDGSVLVTHGG 1044 human
P80456  961 KQEINAKNLTQCWNECLAKSSYFQRKVAVEKFNAENYWKQRGLAIIPFKYPRGLGSVAYGQAAALVHVYLDGSVLVTHGG 1040 rabbit
Q9Z0U5  960 KQEFSAKTLFECWRECMAKCSYSERKTAVGKFNAENSWKKRGMAVIPLKFPVGVGSVAMGQAAALVHIYLDGSALVSHGG 1039 Norway rat
Q06278 1045 IEMGQGVHTKMIQVVSRELRMPMSNVHLRGTSTETVPNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKGTWKD 1124 human
P80456 1041 IEMGQGVHTKMIQVVSRELKMPMSNVHLRGTSTETVPNTNASGGSVVADLNGLAVKDACQTLLKRLEPIINKNPQGTWKE 1120 rabbit
Q9Z0U5 1040 IEMGQGVHTKMIQVVSRELKMPMSSVHLRGTSTETVPNTNASGGSVVADLNGLAVKDACQTLLKRLEPIISKNPQGTWKD 1119 Norway rat
Q06278 1125 WAQTAFDESINLSAVGYFRGYESDMNWEKGEGQPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAIDIGQI 1204 human
P80456 1121 WAQAAFDKSISLSATGYFRGYDSNIDWDKGEGHPFEYFVYGAACSEVEIDCLTGDHKTIRTDIVMDVGYSINPALDIGQV 1200 rabbit
Q9Z0U5 1120 WAQTAFDQSVSLSAVGYFRGYESNINWEKGEGHPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGHSINPALDIGQV 1199 Norway rat
Q06278 1205 EGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELHIALLPPSQNSNTLYSSKGLGESGVFLGCSVFFAIH 1284 human
P80456 1201 EGAFIQGMGLYTIEELHYSPQGILYSRGPNQYKIPAICDIPAELNVTFLPPSEKSNTLYSSKGLGESGVFMGCSVFFAIR 1280 rabbit
Q9Z0U5 1200 EGAFIQGMGLYTIEELSYSPQGILYSRGPNQYKIPAICDIPTEMHISFLPPSEHSNTLYSSKGLGESGVFLGCSVFFAIH 1279 Norway rat
Q06278 1285 DAVSAARQERGLHGPLTLNSPLTPEKIRMACEDKFTKMIPRDEPGSYVPWNVPI 1338 human
P80456 1281 EAVCAARQARGLSAPWKLSSPLTPEKIRMACEDKFTKMIPRDKPGSYVPWNVPV 1334 rabbit
Q9Z0U5 1280 DAVRAARQERGISGPWKLTSPLTPEKIRMACEDKFTKMIPRDEPGSYVPWNIPV 1333 Norway rat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap