2UZ9


Conserved Protein Domain Family
guan_deamin

?
TIGR02967: guan_deamin 
Click on image for an interactive view with Cn3D
guanine deaminase
This model describes guanine deaminase, which hydrolyzes guanine to xanthine and ammonia. Xanthine can then be converted to urate by xanthine dehydrogenase, and urate subsequently degraded. In some bacteria, the guanine deaminase gene is found near the xdhABC genes for xanthine dehydrogenase. Non-homologous forms of guanine deaminase also exist, as well as distantly related forms outside the scope of this model. [Purines, pyrimidines, nucleosides, and nucleotides, Other]
Statistics
?
PSSM-Id: 132012
View PSSM: TIGR02967
Aligned: 22 rows
Threshold Bit Score: 535.682
Threshold Setting Gi: 73536656
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2UZ9_A                48 MEVLRDHLLGV-SDsGKIVFL-EEASQQeklaKE------------WCFKPCEIRELSHHeFFMPGLVDTHIHASQYSFA 113 human
BAA86572              51 MEVLRDHLLGV-SDsGKIVFL-EEASQQ----EKla--------keWCFKPCEIRELSHHeFFMPGLVDTHIHASQYSFA 116 human
CAD15806              34 YQYWEDGLLVI-GA-GKVVRA-GDHAAL----KG------------TLPAGAQVHDYSGK-LIVPGFIDTHIHFPQTDII 93  Ralston...
tigr:BURPS1710b_3023  24 LAYDEDGLLIV-EN-GRVVAA-GAHAAL----AA------------RLAPGATLVEMRDK-LIAPGFIDTHVHYPQTEMI 83  Burkhol...
goetting:GOX0898      31 LHHEPDGLILT-EN-GLIIAA-GSWDSL----RD------------TIPAGTAVDHYPDM-LISAGMIDTHVHYPQLPVI 90  Glucono...
AAQ58254              25 LVHQRDALVVM-EN-GRIAAW-GPAAEL----LP------------SLRPDVRIDHYPDH-LILPGFIDCHVHYPQTEMM 84  Chromob...
tigr:BR0354           26 YRYIEDGAVLV-EN-GRILRL-GDYAEV----SG------------EAGADVKLADHRPH-LVVPGFIDTHIHYPQTQVV 85  Brucell...
WP_028006206          26 YRFFEDGAVFV-SK-GKIAGV-GPYGDV----AK------------HVGPSVKIADHRPH-LVMPGFIDTHLHFPQTQAI 85  Sinorhi...
WP_010975974          26 YAYESDGALLV-EN-GVIKAS-GSYAAV----KA------------AAPEEVPEIDHRPH-LIVPGLIDTHLHFPQMQVM 85  Sinorhi...
XP_642478             24 VEILPNSLIGIdED-GVIQHMkSNYEDL----KQlekdvtmictdnGINEQESVIDMGNK-FLIPGFIDTHAHAPQYHNA 97  Dictyos...
2UZ9_A               114 G-SsIDLPLLEWLTKYTFPAEHRFQNIDFAEEVYTRVVRRTLKNGTTTACYFATIHTDSSLLLADITDKFGQRAFVGKVC 192 human
BAA86572             117 GsS-IDLPLLEWLTKYTFPAEHRFQNIDFAEEVYTRVVRRTLKNGTTTACYFATIHTDSSLLLADITDKFGQRAFVGKVC 195 human
CAD15806              94 A-S-PSPGLLHWLETYTFPEERRFESPQYAAGVASFFLDELLRNGTTSAMVWSTVHRGSAETLFEQARARGMRLITGKVM 171 Ralston...
tigr:BURPS1710b_3023  84 A-S-PAPGLLPWLDRYTFPTERRFADPAHARDVAEFFLDTLLACGTTTALVYCTVHKQSADALFGASEARGLRMIAGKVL 161 Burkhol...
goetting:GOX0898      91 A-S-YGEQLLEWLENYVFPAEARYADITYARAVARQFLTELLRVGTTTAAVYCTVHPQSVDAFFEESERLNTCMIAGKVL 168 Glucono...
AAQ58254              85 A-A-FGEQLLDWLNHYTFVTEQGFADEGHAREVAQVFLDEQLRNGVTTGCVFGTVHAASVDALFEEAASRDLRILAGKVC 162 Chromob...
tigr:BR0354           86 A-S-YAANLLEWLNTYTFVAEQKFADEQHAEFIAEHFLDELIRHGTTTAVAYCSVHPQSVDAYFRASQHRNMRMLGGKVM 163 Brucell...
WP_028006206          86 A-S-YGAQLLEWLNTYIFVEEQKFKAPEHAAFIADRFMDELLSNGTTTAAAYCSVHPESVDAFFTAAEERNMLMIGGKVM 163 Sinorhi...
WP_010975974          86 A-S-YAADLLEWLNTYTFPEECRFVETAHAERIARHFFDEMIRHGTTTATAYCSVHKTSADAFFAESLKRGMCMVAGKVM 163 Sinorhi...
XP_642478             98 GtG-TDLPLLKWLEKYTFPVESKFKDLIFAENVYGKVVDRMLRHGTTTCCYYATIHLEASELLAEIVSKRGQRAFIGKVC 176 Dictyos...
2UZ9_A               193 MD-LNdtFPEY-KETTEESIKETERFVSEMLQKNysRVKPIVTPRFSLSCSETLMGELGNIAKTR-DLHIQSHISENRDE 269 human
BAA86572             196 MDlNDt-FPEY-KETTEESIKETERFVSEMLQKNysRVKPIVTPRFSLSCSETLMGELGNIAKTR-DLHIQSHISENRDE 272 human
CAD15806             172 MD-RN--CPEYlRDTAERGARDAADLIARWHGKD--RLAYAITPRFAPTSSEAQLAACGELARQHpDVFIQTHVAENPDE 246 Ralston...
tigr:BURPS1710b_3023 162 MD-RH--CPEFlRDTAQSGYEDSAELIARWHGHG--RQSYALTPRFAPTSTHAQLEACGALARLHpDVFIQSHVAENLDE 236 Burkhol...
goetting:GOX0898     169 MD-RN--APENlRDTAQSGYDQSAELIARWHNRG--RQLYAVTPRFAPTSTPEQLDLAGALLATKpDLFMQTHLLENRSE 243 Glucono...
AAQ58254             163 MD-RN--APAAlLDTPLAAYEASRALIERWHGKG--RAEYVITPRFAPTSSHGQLEMLGALAAEFpDIAIQSHISENLDE 237 Chromob...
tigr:BR0354          164 MD-RN--APPAlCDTAQSGYDDTKALIARWQGQG--RLDYVITPRFAITSTPEQLEASQTLVREHpECFVQTHLSENHDE 238 Brucell...
WP_028006206         164 MD-RN--APDAlRDTPEKGYDETKALIAKWHGRG--RAHYAISPRFAITSTPEQMEVSRVLAAEHpDCYVQTHLSENRDE 238 Sinorhi...
WP_010975974         164 MD-RN--APQGlLDTPEMSYDETRAVIADWHGKG--RNHVAITPRFAITSTPEQMEVAKSLVGEFpDLHVQTHLSENRDE 238 Sinorhi...
XP_642478            177 MD-RH--SPDHyVETTEQSISNTKEFVDRILAKGnpLVQPIVTPRFAPSCTDELMVALGNLSHEK-QTLIQSHLSENKDE 252 Dictyos...
2UZ9_A               270 VEAVKNLYPSYKNYtsVYDKNNLLTNKTVMAHGCYLSAEELNVFHERGASIAHCPNSNLSLSSGFLNVL--EV--LKHEV 345 human
BAA86572             273 VEAVKNLYPSYKNYtsVYDKNNLLTNKTVMAHGCYLSAEELNVFHERGASIAHCPNSNLSLSSGFLNVL--EV--LKHEV 348 human
CAD15806             247 VKWVAELFPNARSYldVYDRYGLLRRGALYGHAIWLDDGDRRRMAESGAAVAHCPTSNLFLGSGLYNFH--AS--DAHRL 322 Ralston...
tigr:BURPS1710b_3023 237 LRWAAELFPERRSYldVYDHYGLLRRRAVYGHCIHLDDDDRRRFAETGAIAAHCPTSNLFLGSGLFDFE--RA--NARHM 312 Burkhol...
goetting:GOX0898     244 IAWVRELFPDRTSYldVYDKAGLLRPRAILAHAVHAEEADFQRCHHTGCSIAHCPGSNQFLGSGSFPLF--KAlnPERRV 321 Glucono...
AAQ58254             238 IAWVKQLFPGCRDYagVYQRYGLLRRRAIYGHGIHLSEAELEMLHDSGASLAHCPTSNFFLGSGSLDLR--RCveGGKPV 315 Chromob...
tigr:BR0354          239 IAFTRSLYPDAPDYlgIYEHYSLLGNKTLLGHSIHLEEREVRLMAETGSIAVFCPTSNLFLGSGLFDRD--RL--KAAGV 314 Brucell...
WP_028006206         239 IAFATSLYPEAKDYtdIYARYELLGRKTLLGHCIHLSDREISVLAKTGAVGVFCPTSNLFLGSGLFDRD--RF--DRLGA 314 Sinorhi...
WP_010975974         239 IAYTSELYPEATDYtdVYARYGLLGPKSLFGHCIHLSEREADAMSETGSVAVFCPTSNLFLGSGLFPLRglKR--RQKPV 316 Sinorhi...
XP_642478            253 IEWVKSLYPGIESYthVYKHFNLLNERTIMAHCVHLSDEEIKLISTQQTAISHCPISNFTLSSGNLDVR--KV--LEANI 328 Dictyos...
2UZ9_A               346 KIGLGTDVAGGYSYSMLDAIRRAVMVSNILlinkvnEKSLTLKEVFRLATLGGSQALGLdgEIGNFEVGKEFDAILINPK 425 human
BAA86572             349 KIGLGTDVAGGYSYSMLDAIRRAVMVSNILlinkvnEKSLTLKEVFRLATLGGSQALGLdgEIGNFEVGKEFDAILINPK 428 human
CAD15806             323 ALTLATDVGGGSSFSMLRTMGAAHEVARMG------GYHLSALRLFYLATRGAAEALGWqdRIGSFVPGAEADFIVLDPA 396 Ralston...
tigr:BURPS1710b_3023 313 AVTLATDVGGGTSFSMLQTMNEAHKIARMT------GHHLSATRMFWLATAGAAHALDLadTIGTLAPHAEADFVVLDPA 386 Burkhol...
goetting:GOX0898     322 HVGIGSDIGAGPSLSLLQVLSDAYKVAQGL------QTKLHPAQGLWLATAGGAQSLGLedRIGSIRPGLYADLCVFDPA 395 Glucono...
AAQ58254             316 RLGLGTDLGAGTSFSMLQTMNAAYMASQTH------GRPLTAAQAFYLATRGGAEALGIedKVGSIEAGMEADLAVLDLR 389 Chromob...
tigr:BR0354          315 RMAVATDIGGGTSFSMLRTMDEGYKVLQLR------GQRLNPFQSFYMMTLGNARALSMedRIGTLEEGTEADIVVLDSS 388 Brucell...
WP_028006206         315 RHAVATDVGGGTSFSMLETMDEAYKVLHLQ------GQRLSPLNSFYMLTLGNARALDLehRIGSLHAGADADIVVLDSR 388 Sinorhi...
WP_010975974         317 RVSVASDIGGGTSYSMLKTLDEAYKILQLQ------GERLNPFDSFYMMTRGNAEALSLadRIGTLEPGTDADIAVLDMA 390 Sinorhi...
XP_642478            329 KLGLGSDISGGYHPSILQVIRDSIKCSNSHffnngnHTPLTFEEAFYLATVGGSKVVNLdhRIGNFIVGKDFDAQIIDPF 408 Dictyos...
2UZ9_A               426 ASDSPIDLFYGdffGDISEAVIQKFLYLGDDRNIEEVYVGG 466 human
BAA86572             429 ASDSPIDLFYGdffGDISEAVIQKFLYLGDDRNIEEVYVGG 469 human
CAD15806             397 ATPLLARRNSR---AETLEAQLFSLALLGEDRAVAATYIQG 434 Ralstonia solanacearum GMI1000
tigr:BURPS1710b_3023 387 ATPLLARRTAR---AESLEELLFALALLGDDRAVYRTYAAG 424 Burkholderia pseudomallei 1710b
goetting:GOX0898     396 ATPLGRIRAQT---AETLADRLFALTMLGDDRSIAATYVAG 433 Gluconobacter oxydans 621H
AAQ58254             390 STPLLDFRMRY---VRDLSEALFVQMMLGDDRAVAATYAAG 427 Chromobacterium violaceum ATCC 12472
tigr:BR0354          389 ATSPMRLRMAA---GATLEQELFLLQTLGDDRAIVETYVAG 426 Brucella suis 1330
WP_028006206         389 AKPAMELRMQV---ASTLAEELFVLQTMGDDRSVAEVYVAG 426 Sinorhizobium meliloti
WP_010975974         391 ATPAMALRAEV---VNSLADELFLLQTMGDDRAVVETYVAG 428 Sinorhizobium meliloti
XP_642478            409 VQNSPFDCFDG----ETLKDIFQKFIYLGDDRNLSSLYIKG 445 Dictyostelium discoideum AX4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap