Conserved Protein Domain Family
SigX5

?
TIGR02960: SigX5 
RNA polymerase sigma-70 factor, TIGR02960 family
This group of sigma factors are members of the sigma-70 family (TIGR02937). They and appear by homology, tree building, bidirectional best hits and one-to-a-genome distribution, to represent a conserved family.
Statistics
?
PSSM-Id: 132005
View PSSM: TIGR02960
Aligned: 4 rows
Threshold Bit Score: 459.711
Threshold Setting Gi: 490061073
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAB49376      18 ILDRPAFERLTTTHRRALKLHCYRMMGSLHEADDLVQETFLKAWRGRAQFDGRGSPRGWLYTIATNACLNAIKARSSAHR 97  Mesorhizobium l...
BAC71074       4 GTATTDLDVRLEKHRVELTGYCYRMLGSSFEAEDAVQDTMVRAWRSYEKFEGRSSLRSWLYRIATNVCLDMLTAGNKRAR 83  Streptomyces av...
AAS06171      39 SVVGADFTAHAEPYRRELLAHCYRMTGSLHDAEDLVQETLLRAWKAYDRFEGKSSVRTWLHRIATNTCLSALEGRQRRPL 118 Mycobacterium a...
WP_003963322  74 AGDQSAFGELAARHRHELHVHCYRMLGSFTEAEDMVQETLLRAWDKRTTFEGRSGFRAWLYRIATNACLDTLARRRRRTT 153 Streptomyces cl...
BAB49376      98 ILEEPArPPSEGRAAAGLAAELSWLEPYPDAElpdLIDGEPGPDARYETSEAVRLAFVAAIQLLPPRQRASLLLCDVLGW 177 Mesorhizobium l...
BAC71074      84 PMDLTD-STPLAQAALSPRPDSTWLEPMPDVR---VLPTASDPAEAAVAKESVRLAFMAALQRLPPKQRAVLILREVLAW 159 Streptomyces av...
AAS06171     119 PVGLGA-PSADPTAELVERREVPWLEPLPALT---DDP--ADPSVIVGSRESVRLAFVAALQYLSPRQRAVLLLRDVLGW 192 Mycobacterium a...
WP_003963322 154 AAVDSG-----GGPAASVAAEVTWLQPCPDRLldlAAPAAAEPETAAIGRETIELAFLAAIQHLPPRQRAVLVLRDAAGL 228 Streptomyces cl...
BAB49376     178 SALETAQLLGGSTASVNSALQRARATLGERYPQGrPQQR--SQPNPEEGVLLERYISAWQAANLDGFIALLREDATYHMP 255 Mesorhizobium l...
BAC71074     160 KASEVAELLDTSVASVNSALQRARATLADSEGAA-ADAAvsDPLDEEQQKLLERYVAAFEGYDMAALTALLHEDAVMTMP 238 Streptomyces av...
AAS06171     193 RAAEVAEAIGTTTAAVNSLLQRARAQLDAVGPSA-DDQLa-QPDSAETQDLLARYIAAFESYDIDRLVELFTAEAIWEMP 270 Mycobacterium a...
WP_003963322 229 PAQETADTLEMSVPSVKSALQRARATLREHLPEKrTDWNaaTGPTPAERALLDRYVAACRRSDLPALTALLHEDARQCMP 308 Streptomyces cl...
BAB49376     256 PWRDWYRGRPAIHGFFKTV--WGNFAGYRAVATR-ANGQPAVAIYARRHQEPEWRAQSLHVIEPAYGAIASLTVYVAplG 332 Mesorhizobium l...
BAC71074     239 PFDLWLCGTPDITGFMTTL--GAACAGSRLLPVQ-VNGLPGFAQYKPDPEAGGFTPWALQVLEISDGRLTGFHFFLD--T 313 Streptomyces av...
AAS06171     271 PYTGWYQGARTIVTLIHQQcpAEGAGDMRLLPLI-ANGQPAAAMYMRAGDV--HLPFQLHVLDVRGDRVSHVVAFLD--- 344 Mycobacterium a...
WP_003963322 309 PAHLVFSGREAILDMWRPVleGEGSWGVWYSRTLeVNRQPAAVNYVRRPGAERYTAVNIDVLRIENGLITDITTF----G 384 Streptomyces cl...
BAB49376     333 PGLFAAFGL 341 Mesorhizobium loti MAFF303099
BAC71074     314 KRWFPLFGL 322 Streptomyces avermitilis MA-4680 = NBRC 14893
AAS06171     345 DSLFAKFGL 353 Mycobacterium avium subsp. paratuberculosis K-10
WP_003963322 385 PELLPAAGL 393 Streptomyces clavuligerus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap