Conserved Protein Domain Family
SigZ

?
TIGR02959: SigZ 
RNA polymerase sigma factor, SigZ family
This family of RNA polymerase sigma factors is a member of the Sigma-70 subfamily (TIGR02937). One of these is designated as SigZ in B. subtilis (Swiss_Prot: SIGZ_BACSU). Interestingly, this group has a very sporatic distribution, B. subtilis, for instance, being the only sequenced strain of Bacilli with a member. Dechloromonas aromatica RCB appears to have two of these sigma factors. A member appears on a plasmid found in Photobacterium profundum SS9 and Vibrio fischeri ES114 (where a second one is chromosomally encoded).
Statistics
?
PSSM-Id: 132004
View PSSM: TIGR02959
Aligned: 7 rows
Threshold Bit Score: 254.213
Threshold Setting Gi: 32444597
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O05409          7 WDQFHQPLKTYISHRVNDQSIVDDLLQIVFMKIQVHLPNLIDEQKIDSWIYRITRNTIIDFYRTKKTSEILPDVLHFNDS 86  Bacillus subti...
tigr:CHY_1709  12 SKEFYQLLKNFIKKQVSQESDVEDILQEVMIKIYKNIDKLNDSSKLQSWIYQIAKNTIIDYYRKQSKSIFLHDNLVFYSS 91  Carboxydotherm...
ABB33010       32 WQEYHLRLRAFIKSRIADDAVADDTLQNVFLKMHAGLPSLKDGTKLQSWLYQIARNAIIDLYRSQKASTGIPVSLAHPES 111 Geobacter meta...
CAD74599       29 WNLFGEELRTFLLRRVSAAQVAEDLLQETFVRIHTKLNEVDDQQRIRSWVFQIARNLVVDHYRSKSREAAALADEIAANG 108 Rhodopirellula...
vfiat:VF0972    5 WQNHKAQLRNYVYKRVDDASAVDDILQDVYIKASSNLHQLKSKGSLKGWLYKIAYNTIMDFYRDKLPYDELPEDLVAEDE 84  Vibrio fischer...
CAG22124        7 WSAYRSQLKAFLHSKVSNSADVEDLLQEILIKTHNSLGSLQKGDSIQSWLFQIANRTTIDFYREKGRTKELEAEELWF-G 85  Photobacterium...
jgi:Daro_2950   8 WDEHRSELLHFVANRIPDLQEANDVVQEVFLRATRLERGLCGIANRRAWLFQVARNLLIDRYRLTRYEVVLDESQLTAVD 87  Dechloromonas ...
O05409         87 AEEENFTKEATVCIRSTIKRLPEKYREALELTDFQGLSQKELSEKLGISYSGAKSRVQRGRGKLKQLLEGCCHIEADRYG 166 Bacillus subti...
tigr:CHY_1709  92 PVESTFNKEIAQCLKNMIDHLPDPYRQAILLTEYHGFTQKKVSEKLGLSVSGVKSRVQRARKMLKNMLENCCYLEFDRLG 171 Carboxydotherm...
ABB33010      112 NPGEKAVQELSDCLQPMIQRLPEIYREAIILSELEGLTQREVAEVLGTSLSGAKSRVQRGRALLKGMIADCCRLELDHNG 191 Geobacter meta...
CAD74599      109 EREESLEDVVIGWLPKMLAQLPEEQREAVELYEIQGLSQQEIANKLGLSLSGAKSRVQRGRSKLKQVLFDCCSFEHDRRG 188 Rhodopirellula...
vfiat:VF0972   85 DAVEESRKEIAECMRPLIDELPDKYSVPLRLAELDGIPQQEIADKLGLSLSGAKSRIQRGRVKFRENLMTCCDFEINDGG 164 Vibrio fischer...
CAG22124       86 KREENIKADLSPCIEPFLKALPDDMAHLLRAIDLEGQSPKAYAQELGLSYTTLKSRVKKGRTALRGLFEGCCHYSLDQHG 165 Photobacterium...
jgi:Daro_2950  88 AEPITPVDSLSQCIPRVLTELSVEDREAITLCDIEGISQQDFADRIGVTLPAAKSRVQRARKRLREQLVTACQVRFDEVG 167 Dechloromonas ...
O05409        167 NIVDFRILKE 176 Bacillus subtilis subsp. subtilis str. 168
tigr:CHY_1709 172 NIIDYQHKDT 181 Carboxydothermus hydrogenoformans Z-2901
ABB33010      192 RLCDYERKGK 201 Geobacter metallireducens GS-15
CAD74599      189 NLIGYERNHS 198 Rhodopirellula baltica SH 1
vfiat:VF0972  165 MVTGYTPKKT 174 Vibrio fischeri ES114
CAG22124      166 SLIDFDQKSN 175 Photobacterium profundum SS9
jgi:Daro_2950 168 QVCCFVPRGP 177 Dechloromonas aromatica RCB
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap