Conserved Protein Domain Family
SigX4

?
TIGR02957: SigX4 
RNA polymerase sigma-70 factor, TIGR02957 family
This group of sigma factors are members of the sigma-70 family (TIGR02937). They and appear by homology, tree building and bidirectional best hits, to represent a conserved family. This family is found in a limited number of bacterial lineages. This family includes apparent paralogous expansion in Streptomyces coelicolor A3(2), and multiple copies in Mycobacterium smegmatis MC2, Streptomyces avermitilis MA-4680 and Nocardia farcinica IFM10152.
Statistics
?
PSSM-Id: 132002
View PSSM: TIGR02957
Aligned: 9 rows
Threshold Bit Score: 380.931
Threshold Setting Gi: 29604549
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Bcep18194_B0094   6 QTFRALRPRLQKIAYRMLGSVADAEDIVQDVWLRWHEA-ARDSIENTEAWLVSVTTRTSIDRLRAAKIRREHYTGIWLPE 84  Burkhold...
BAB04391              6 EDYEQLKPLLFSLGYRLLGSVTDAEDLVQETFLRAYQA-EEREINNKKAYLCKMMTNRCLDVLKSARRKREQYVGPWLPE 84  Bacillus...
jgilanl:BCZK2206      5 QLYEAYQPLLFSLAYRILGSVMDAEDIVQDVFISLNNIeDLQSIENMKAYLCKMATNRSIDKLRSAAYKRNVYVGMWLPE 84  Bacillus...
novoz:BL00106         2 EYYRQYHSLLFSIAYRMLGSFQDAEDIIQELFADLQEK-DIGQIDHIQAYLTKSITNRCINELQSARKKREVYIGEWLPE 80  Bacillus...
BAC88610             12 ETFQQHRGMLFAIAYRMLGTVADAEDMVQETFLRWQQA-SAAGVQSQKSYLAAVVTRLSIDHLRSARVRREQYVGPWLPE 90  Gloeobac...
CAB66281             29 EAFVTHRNLLFTVAYEMLGSAADAEDVLQETWLKWAGV-DLDTVRDRRAYLVRITTRQALNRLRTLGRRKESYVGSWLPE 107 Streptom...
BAC68619              5 EEFEELRPLLFSVAYRILGSVSEAEDAVQETWLRYEL--SPARPASARAFLSAVVTRVSIDVLRSARMRREEYVGPWFPE 82  Streptom...
BAD60131              7 REFQAHRPRLFALAYRMLGSATEAEDAVQETYLRWAGA-DRSQIRTPEAWLTTAVVNLCRTWLVSARARRESYVGPWLPE 85  Nocardia...
WP_011727832         21 AVFTRVRPRLFGVAYRMTGTVAEAEDAVQEAWLRWQDT-DRAAVTDPVPFLMTVVTRICLNVLQSARARHETYIGPWLPE 99  Mycobact...
jgi:Bcep18194_B0094  85 PEFGEsPATPEEMTERADDVSVAYLLLLERLTPEARAAFLLREVFDADYDEIADAIGKSEAACRQLVSRAKAQLrDDDRP 164 Burkhold...
BAB04391             85 PLLIT-SDDPSEAILQKEGLSMAYLRMMEHLTPHERAVFLLREVFTFSYREIASMMEKKEDNCRKLYSRAKEKL-SAVKG 162 Bacillus...
jgilanl:BCZK2206     85 PLVEE-SNEPSESFAMKESLSTAYLLLLQQLSEVERIVFILREVFSYEYEEIASIVDKSSVNCRKIFQRARKSI-LDKPK 162 Bacillus...
novoz:BL00106        81 PQVALsAQIPAEYVEEKEKVSYAFLVVMSRLNPVERAVLMFREVFGYHYKEISSIIGKSEANCRQIHSRLKQKL-NEDIS 159 Bacillus...
BAC88610             91 PLAQT-AADPLQQSELADSLSMAFLVLLESLSPLERAVFLLSEVFEYDHAEIARIVDKSPANCRQILRRARRHL-AERQP 168 Gloeobac...
CAB66281            108 PLLTT--PDVAEDVELADSVSMAMMLVMETLAPTERAVFVLREVFDLGYDEIAEAVEKSPAAVRQIAHRARAHV-AARRP 184 Streptom...
BAC68619             83 PLLTDpYEDPEQSAELADSLSMAALLLLERLSPLERAVFVLREVFAFGFPEIASAVGRSEAACRQLAVRARRHM-DAGRP 161 Streptom...
BAD60131             86 PVPTA-ELGPLETVELRESVSLALLTALERLNPLERAVFVLHAAFGYPHREIAEMLDVSDSAAQQAYHRATQRV-RLGRN 163 Nocardia...
WP_011727832        100 PVDTT--ADPALGAERGAALELATLMLLERLAPPERAAYILREAFDYPYEQIAETVGVSVPNARQLVSRARRRV-TTRRA 176 Mycobact...
jgi:Bcep18194_B0094 165 rHIVPRETHRQLLQTFSHALAQGDFPSIQALLAEDAMLIGDGGGKVQSFPKPMVGGRRIAQLFYATWLRCGS-GVEMRPV 243 Burkhold...
BAB04391            163 -ESLHYENNRSVVDRFIHSFQTEDQGDLLELLSDHVTLYTDGGGKVRAALRPIYTKDHVAAFLFGIAKKRPN-DFYVEVK 240 Bacillus...
jgilanl:BCZK2206    163 qSTLSTKKMAAYVEKFVSSLQCGDAQGMLEVLKTDAVLKADGGGKVTTAIHPIYSADRIIRLFFGIVQRLTK-EYTVDFK 241 Bacillus...
novoz:BL00106       160 -VFSQPVEEQQLAQLFIESAKTGNFEEFSKKLIEDAVLYTDGGGKVRSALRPIYGKSRIYAFFTGVVSKGSF-SGRFMPV 237 Bacillus...
BAC88610            169 rFRSSRPHSEKLVARFLQACSGGDLEGLLAVLAPEVTLVGDGGGKVAATIRPLQGAARVARFFVALRRRVG--HFTLMPT 246 Gloeobac...
CAB66281            185 rGAVSATESREALAAFQRAVETGDLQGLLDILSPDVVLLGDGGGIKQAVLRPVVGADKVARLMLGGLVKLDM-EMRMDPA 263 Streptom...
BAC68619            162 rFEADRKEREELAERFFEALREGNVDGLRELLAADVSLVGDGGGKAPQWARGFFGVGQVSQMLATLFPPFFRiGGVVDPH 241 Streptom...
BAD60131            164 rFEVSAERARALLERFLVAASTGDVAALRSLLTADATATADGGGVINAARRPVEGADRVARYLLGLFRRQVP-GMVIGVE 242 Nocardia...
WP_011727832        177 -APVATAEQDRLLRAFVTAARSGDLDALEEILAEDVVSHTDGNGARNAAQIPVVGRTTVAKFVRAFRNRLWP-GASLRWI 254 Mycobact...
jgi:Bcep18194_B0094 244 VLNDEWAMLRF-IAGQLESAMAFET--DGTRIVRILVQRNPDKLARIA 288 Burkholderia lata
BAB04391            241 NVNGQPALISY-ADSKLYNVICFYI--VGGQIQDIYIIMNPEKLPSNG 285 Bacillus halodurans C-125
jgilanl:BCZK2206    242 MVNGMPGVIVT-INNKITYVLSFAF--EDEKISNIYMVVNPEKLMHLN 286 Bacillus cereus E33L
novoz:BL00106       238 DINDQKGVLIM-KNNRPAYAVCFAWnpEGDSVKNVFIVSNPDKLKHIK 284 Bacillus licheniformis DSM 13 = ATCC 14580
BAC88610            247 VINGQSGIAFL-VAGNLQSAMTFDI--TEAGIQTIYSVRNPEKLQRFA 291 Gloeobacter violaceus PCC 7421
CAB66281            264 QVNGHPALVIR-LDGELDTVVAVRL--DEGRITGLYAVRNPEKLSYMR 308 Streptomyces coelicolor A3(2)
BAC68619            242 QVNGQPGALFRdRDGKVLNTWTLDI--LGGQIQAIRTVSNPDKLGHLG 287 Streptomyces avermitilis MA-4680 = NBRC ...
BAD60131            243 DANGAPALVVR-VAGAPMLVVGIDY--TEHGIAAVRLVVNPAKLAAFG 287 Nocardia farcinica IFM 10152
WP_011727832        255 TANGHSAVLVV-HDDSPAAFLTVAA--SADGIHRLLWVLAPEKLAGIA 299 Mycobacterium smegmatis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap