Conserved Protein Domain Family
TMAO_TorT

?
TIGR02955: TMAO_TorT 
TMAO reductase system periplasmic protein TorT
Members of this family are the periplasmic protein TorT which, together with the the TorS/TorR histidine kinase/response regulator system, regulates expression of the torCAD operon for trimethylamine N-oxide reductase (TMAO reductase). It appears to bind an inducer for TMAO reductase, and shows homology to a periplasmic D-ribose binding protein.
Statistics
?
PSSM-Id: 132000
View PSSM: TIGR02955
Aligned: 6 rows
Threshold Bit Score: 466.166
Threshold Setting Gi: 73855028
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAG19642          57 KICAVYPHLKDSYWLSINYGMVEQAKILGITLKVLEAGGYPELEKQKGQLQYCKKWGADAIILGTVDRTAYNGILSQFTG 136 Photobacter...
AAF96609          47 KLCALYPHLKDSYWLSVNYGMVEEARKLNLNLRVMEAGGYPNHHKQQQQIALCVRWGADAILLGTVSPELYQDDLAHYTR 126 Vibrio chol...
vfiat:VF1620      28 KLCAIYPHLKDSYWLSVNYGMVKEAKAQHVELTVYESGGYPNVERQTQQIEQCVLNGSDAIILGTVDPMAFQANLITLTK 107 Vibrio fisc...
mgcchina:SSO1002  46 KLCALYPSLKDSYWLSLNYGMQEAARRYGVDLKVLEAGGYSQLATQQAQIDQCKQWGAEAILLGSSTTSF--PDLQKQVA 123 Shigella so...
tigr:CPS_1827     54 KLCAVYPHLKDSYWLSINFGMTEQAKQRSIELKVLDAGGYQNKDEQLRQIEQCIHWQASAILVGSVNFEALNQKLAQVNK 133 Colwellia p...
AAN54297          60 RLCVLVPHLKDAYWIGIDYGLIQHAKHLGVSLDLFEAGSYYHQDKQLAQLRSCMSGDYDAILLGAVSPNLLEHFPLPLSK 139 Shewanella ...
CAG19642         137 DIPVFSMTNDIDMSDpeikmhIKAKVGVDWYYMGKQAGVFLAQ-RHPK--GSGKMKVAWLPGPKQRGGTKAVTTGFYDAL 213 Photobacter...
AAF96609         127 SVPVFATVNQLRLNEqqq-ehLKGEVGVDWYWMGFYAGEYLAR-KHPK--GSGEIKIVVLPGPASSGGTKPVLQGLEEAI 202 Vibrio chol...
vfiat:VF1620     108 GIPVFATVNQLISSYppatpvHHGEVGVDWYEMGYKTGEFLAK-RHPK--DSGITYIGWLPGPKTRGGTKPVTQGFNDAI 184 Vibrio fisc...
mgcchina:SSO1002 124 SLPVIELVNAIDAPQ------VKSRVGVPWFQMGYQPGRYLVQwAHGK-----PLNVLLMPGPDNAGGSKEMVEGFRAAI 192 Shigella so...
tigr:CPS_1827    134 HTPVFALVNEIATNN------ISGRTGVSWYQMGYQLGEYLVK-HHQNnfNTTPATLAWFPGPKRGGGSLQSTKGLQAAL 206 Colwellia p...
AAN54297         140 --PIIALVNKLNSDQ------VLTHIGVNWYQMGLRAGQFIKA-DAKVhtPTQPTTLALLAGPENVGGTDLVEQGIRHAL 210 Shewanella ...
CAG19642         214 QDSDIEVVSTLWADNSKELQRNLIQQLFtEHPDINYIVGGAVAAEVAISELRTNHRTDDVKIISTYLSHGVYRGLRRGKI 293 Photobacter...
AAF96609         203 SHSDVRITEILWADNDKELQRNLIQQAL-EQPDVRYLVGSAVAIEAAISELRSLNKSDQIGLIATYLSHGVYRGLLRGRV 281 Vibrio chol...
vfiat:VF1620     185 KDSDIIVSATYWGDNSKELQRNLIQDAL-QTEKLDYLVGGAVAIEVAISEVASRKMQNQVGLVSTYLSHAVYRGLLRNRV 263 Vibrio fisc...
mgcchina:SSO1002 193 AGSPVRIVDIALGDNDIEIQRNLLQEMLeRHPEIDVVAGTAIAAEAAMGE--GRNLKTPLTVVSFYLSHQVYRGLKRGRV 270 Shigella so...
tigr:CPS_1827    207 VNSPIEIIAIEHGLNEKITQFSLLKDTLkKYNNIDYLAGNAVMAEMAINEVGRLPKEQQPEILSHYLSHGVYRGIKRHKI 286 Colwellia p...
AAN54297         211 EGSNVSISAIQHADNNRNLYRDQLQILL-KAQQPNYILGSAVAIEAAVSTLKQKHMTQDIKLVSSYLSPAILRGLKRQKV 289 Shewanella ...
CAG19642         294 LFSPTDKMAQQAQMSIDQAVRYLENKPMEFDLAPKIQPLTPEYLPREVITDSLSPAEYRPVFNV 357 Photobacterium profundum SS9
AAF96609         282 EFAPTDQMVEQGRLSVRQAAAFLRNKPYAIQQAPKIEALTPQHLERKIIADSLSPSEYRPVFQV 345 Vibrio cholerae O1 biovar E...
vfiat:VF1620     264 LFSPTDKMVLQGQLSIQQAVSYLNKHPLSFQLSPKIEALTPQHLPKKVLEESLSPAEYRPTFFV 327 Vibrio fischeri ES114
mgcchina:SSO1002 271 IMAASDQMVWQGELAVEQAIRQLQGQSVSDNVSPPILVLTPKNADREHIRRSLSPGGFRPVYFY 334 Shigella sonnei Ss046
tigr:CPS_1827    287 LMANSDQMVLQGKMAINQAVDYLKIGKVKTLQAPTIITIDQATIKKLKTELSLSPSNFKPIYSI 350 Colwellia psychrerythraea 34H
AAN54297         290 LYSNDDLVVLQGKLAIDVAVKQLEGATPFGDIGPAIVGRTMSANTQSELSFSLAEADFYPLYQV 353 Shewanella oneidensis MR-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap