Conserved Protein Domain Family
Sig70_famx2

?
TIGR02952: Sig70_famx2 
RNA polymerase sigma-70 factor, TIGR02952 family
This group of sigma factors are members of the sigma-70 family (TIGR02937). They and appear by homology, tree building, bidirectional best hits and one-to-a-genome distribution, to represent a conserved family. This family is found in a limited number of Gram-positive bacterial lineages.
Statistics
?
PSSM-Id: 131997
View PSSM: TIGR02952
Aligned: 4 rows
Threshold Bit Score: 250.877
Threshold Setting Gi: 3025463
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAB55345      90 LVERAQAGEADAFGRLYDQYSDTVYRYIYYRVGGKATAEDLTSETFLRALRRIGTFTYQGR-DFGAWLVTIARNLVADHF 168 Streptomyces co...
tigr:DET1348   7 LVELAQQKDEHAFARLYEEYFDKIYRYIALKIGNKMEAEDLTQQVFMNMLRSISSFKWQDNtPFSAWLYRIAHNQIVDYL 86  Dehalococcoides...
AAC12856       8 NLDKMEDRE-RAFSYIFETYSKRVYNYIYYRVNCQYTAEDLMSKIFEKVMLKIDSYSEKKS-SFEVWLFTIARNVLNDYF 85  Clostridium ace...
WP_012258966   7 LLRRAYELDTDALAAIHDTYYQPLYRYISFRVGDRYTCEDLVSEVFTRFLSTLRQRKSLPN-NLRGWLFGVAANVVSDHF 85  Chloroflexus
CAB55345     169 KSSRFRLEVTTGEMLDANEVERsPEDSVLESLSNAALLDAVRRLNPQQQECVTLRFLQGLSVAETARVMGKNEGAIKTLQ 248 Streptomyces co...
tigr:DET1348  87 RKRSRQPVLDIEVVTPLACADD-PVETTEVNIDYEKFVEVSGKLTPAQQEVISLRFSSDLPIAEVAKIMNKTPGAVKALQ 165 Dehalococcoides...
AAC12856      86 RGLKRHTLFSLDVFKELLSNEPnPEEAILKEEANYKLLKALKILSKKERHIIALKFGANLKNKEISELLGIKSNNVGIIL 165 Clostridium ace...
WP_012258966  86 RRSYRSPQTSLDE--QLMSREPlPSEIAEKAATNEELRLAISQLTPDQQHVLALRFAQNLPIQEVARILGKTEGAVKQLQ 163 Chloroflexus
CAB55345     249 YRAVRTLARLL 259 Streptomyces coelicolor A3(2)
tigr:DET1348 166 HSAVSSLRRML 176 Dehalococcoides mccartyi 195
AAC12856     166 FRTIKKLKSQM 176 Clostridium acetobutylicum ATCC 824
WP_012258966 164 ARAIAALARQM 174 Chloroflexus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap