Conserved Protein Domain Family
DMSO_dmsB

?
TIGR02951: DMSO_dmsB 
DMSO reductase, iron-sulfur subunit
This family consists of the iron-sulfur subunit, or chain B, of an enzyme called the anaerobic dimethyl sulfoxide reductase. Chains A and B are catalytic, while chain C is a membrane anchor.
Statistics
?
PSSM-Id: 131996
View PSSM: TIGR02951
Aligned: 10 rows
Threshold Bit Score: 268.909
Threshold Setting Gi: 499712167
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAL21423      14 QLGFFIDSSRCSGCKACQVACKDKNNLEVGRRFRRVYEVKGGSFIPTGQGgVSN-NVFAYTLSISCNHCADPVCTKNCPT 92  Salmonella ente...
AAT82269      12 KYGFFFDQTLCTGCKACQIACIDKHDLPTGVRWRRVVEYSGGTWQISGDT-FNP-SVFTYYTSVSCNHCEDPICMKVCPT 89  Propionibacteri...
BAD41316       2 QYGFFIDAKYCAGCKTCQIACKDRASLEVGQLFRKVVNYEDGGWVQRGEG-WVH-NVTSYWFSISCNHCADPACVYVCPT 79  Symbiobacterium...
BAD39697       3 QKGFYYDMTACVGCKACYIACKDKNDLPLGVMYRNVYTFEGGRY---------P-KPWIFNISISCNHCSDPRCVTNCPT 72  Symbiobacterium...
BAC59711       6 QYGFYIDSSKCTGCKTCQLSCKDNKDLGIDRNFRRVYEYVGGNWTEE-NGaFRQ-NVFAYYLSISCNHCTNPACTKVCPS 83  Vibrio parahaem...
CGGMC:SC4184   3 QYGFYVDSSRCSGCKTCQVSCKDNKDLDVGPKLRRVYEYGGGSWVKEGES-WHH-DTFTYYLSIACNHCDEPVCVSGCPT 80  Salmonella ente...
AAN57325       6 QYGFYVDTTKCSGCKTCQVACKDRSDIEVGKQWRRTYEYCGGNWTADGQGaYHQ-DVFAYYISISCNHCSNPVCVKACPT 84  Shewanella onei...
CAE10492       6 QFGFYLDQTRCVGCRTCQMACKDGKDSPLGVNFRRVVEFEGGAWLTENPDtPTPvGVFAYYTSIACNHCDDPACIKACPT 85  Wolinella succi...
WP_011392898   4 QLGFHVQQDRCIGCFTCQIACKDKNDLEVGQLFRRVREIAGGGYTETGNNaFRA-DVYAYWISLSCNHCQDPPCVKNCPT 82  Moorella thermo...
WP_011392901   3 QLGFYYDMTACIGCKTCQVACKDKNNLEVGVLFRRVYTVEGGKF---------P-HPWFYHISLGCNHCAQAPCVRNCPT 72  Moorella thermo...
AAL21423      93 TAMHKRpGDGIVRVDTDKCVGCGYCAWSCPYGAPQLNEQTGQMSKCDMCVDLLAKGEPPVCVATCPLEAIKFGPIDELRA 172 Salmonella ente...
AAT82269      90 TAMSRR-DDGTVYVDQDKCVGCRYCEWACPYSAPQYRKDTGRMSKCDLCYDYRSKGKEPACVAACPSRALDWGPIDELRS 168 Propionibacteri...
BAD41316      80 GAMYKRsDNGLVLVNQDDCVGCQSCVWACPYDAPQYNPEVGRVHKCDGCIDRVEAGQRPVCVDACPYQLIDFGDIEELRA 159 Symbiobacterium...
BAD39697      73 GASYKReEDGLVLVDQEACIGCQYCVWSCPYGARHYLEEQGVVGKCNGCVDLVERGQNPACVDACVMRALEFGDLDELKR 152 Symbiobacterium...
BAC59711      84 GAMHKReEDGFVVVDESVCIGCKSCHMACPYGAPQYSEEKGHMTKCDGCYERVAEGLMPICVDSCPLRAIEFGPIDELRA 163 Vibrio parahaem...
CGGMC:SC4184  81 GAMHKRkEDGLVVVDDSVCVGCRYCEMRCPYGAPQFDTQANVMRKCDGCLDRLENNLRPICVDSCPQRALDFGPVDELRA 160 Salmonella ente...
AAN57325      85 GAMYKErSTGLVKVNQDLCIGCESCARACPYDAPQIDPQRKVMTKCDGCSDRVAKGLKPSCVMSCPQRALDFGLIAELKQ 164 Shewanella onei...
CAE10492      86 GAMHKG-LYGIVEVNQSRCIGCKACAMACPYGAPQFDSRQGHMSKCDGCKTRLEENLAPLCVESCPFRALEAGPITELRA 164 Wolinella succi...
WP_011392898  83 GAMQKRpEDGIVFVDQNKCIGCRYCVWSCPYGAPQYNPQIGKVGKCDFCRDLLAKGEQPACVAACPMRVLDFGPLDELKK 162 Moorella thermo...
WP_011392901  73 GALYKR-EDGIVMQDRNKCIGCRYCVWSCPYGAPQYIASEGKVGKCNLCADLIDRGEQPACVAACMMRALDFGDIEELRR 151 Moorella thermo...
AAL21423     173 KYG 175 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
AAT82269     169 TYG 171 Propionibacterium acnes KPA171202
BAD41316     160 KHG 162 Symbiobacterium thermophilum IAM 14863
BAD39697     153 RHP 155 Symbiobacterium thermophilum IAM 14863
BAC59711     164 KYG 166 Vibrio parahaemolyticus RIMD 2210633
CGGMC:SC4184 161 KYG 163 Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
AAN57325     165 QYG 167 Shewanella oneidensis MR-1
CAE10492     165 KHG 167 Wolinella succinogenes
WP_011392898 163 KYG 165 Moorella thermoacetica
WP_011392901 152 KYG 154 Moorella thermoacetica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap