Conserved Protein Domain Family
SigW_bacill

?
TIGR02948: SigW_bacill 
RNA polymerase sigma-W factor
This sigma factor is restricted to certain lineages of the order Bacillales.
Statistics
?
PSSM-Id: 131993
View PSSM: TIGR02948
Aligned: 3 rows
Threshold Bit Score: 338.407
Threshold Setting Gi: 10172875
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAD74435        1 MDLFIKKRIKAIQKGDQNAYADLVDLYKDKIYRLCYRMLGNRHEAEDAAQEAFIRAYIHIDTYNPEMKFSTWLYRIATNL 80  Geobacillus ka...
novoz:BL02699   1 METMIKKRIKQVKKGDRNAFADIVDIYKDKIYQLCYRMLGNAHEAEDIAQEAFIRAYVNIDSFDINRKFSTWLYRIATNL 80  Bacillus liche...
BAB03982        1 MDSIDKRLVREVRAGDEQAFAELVELYKDKVYQVAYRMVGNVHEAQDVAQEAFLRAYTNIDTYDIQRKFSTWLFRIATNV 80  Bacillus halod...
BAD74435       81 TIDKLRKRKPDVYLDEEVGGTDGLTMQAQLPSREASPEEAVESLELQETVQRAIEQLPEKYRSVIVLKYMEDLSLQEISE 160 Geobacillus ka...
novoz:BL02699  81 TIDRIRKKKPDYYLDAEVAGTEGLTMYSQVAADVALPEDEVVSLELHSTIQEKILRLPDKYRTVIVLKYIDELSLIEISE 160 Bacillus liche...
BAB03982       81 AIDRLRKRKPDFHLEDPVQGADGLTIESQLAADEEPVDDQVIQMETRDWIQQEIQALPPKYRMAVLLKYMEDLSLKEISD 160 Bacillus halod...
BAD74435      161 ILGLPVGTVKTRLHRGREALRRQLGHL 187 Geobacillus kaustophilus HTA426
novoz:BL02699 161 ILNIPVGTVKTRIHRGREALRKQLRDL 187 Bacillus licheniformis DSM 13 = ATCC 14580
BAB03982      161 ILDLPVSTVKTRIHRGREALRKRMRHV 187 Bacillus halodurans C-125
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap