Conserved Protein Domain Family

TIGR02947: SigH_actino 
RNA polymerase sigma-70 factor, TIGR02947 family
This group of sigma factors are members of the sigma-70 family (TIGR02937). They and appear by homology, tree building, bidirectional best hits and (with the exception of a paralog in Thermobifida fusca YX) one-to-a-genome distribution, to represent a conserved family. This family is restricted to the Actinobacteria and each gene examined is followed by an anti-sigma factor in an apparent operon.
PSSM-Id: 131992
Aligned: 3 rows
Threshold Bit Score: 368.531
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
AAT83014     173 MGTVMSRLNRARKQLRKQLVDVAGARGIGPRAG 205 Propionibacterium acnes KPA171202
BAD59435     180 IGTVMSRLHRGRKQLKGLLADVARERGFNRSER 212 Nocardia farcinica IFM 10152
WP_011692492 214 IGTVMSRLHRGRKMLRDMLGDYAAERGFKAATE 246 Arthrobacter sp. FB24
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap