Conserved Protein Domain Family
SUF_assoc

?
TIGR02945: SUF_assoc 
FeS assembly SUF system protein
Members of this family belong to the broader pfam01883, or Domain of Unknown Function DUF59. Many members of DUF59 are candidate ring hydroxylating complex subunits. However, members of the narrower family defined here all are found in genomes that carry the FeS assembly SUF system. For 70 % of these species, the member of this protein family is found as part of the SUF locus, usually immediately downstream of the sufS gene. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 131990
View PSSM: TIGR02945
Aligned: 15 rows
Threshold Bit Score: 152.455
Threshold Setting Gi: 499471378
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012031155  19 PLERAVIEALKSVYDPEIPVDIYELGLIYHIDCDTvA-KKVIVYMTLTAPGCPVAGVMPDWVKEAIEKVDGVSDCTVEMV 97  Dichelobacter n...
WP_010946343  24 SIKEGVITALRGVFDPEIPVNIYDLGLIYDIAVND-E-GHVHIQMTLTTPGCPVAQTFPGTVEQAVNQVEGVSDCTVELV 101 Legionella pneu...
WP_011240342  46 KLKAEIIETLRDIYDPEIPVNIYDLGLIYDIEIGD-D-NHVVIKMTLTTPNCPVAGSMPAEIELRVGQIKGVGAVEVELV 123 Zymomonas mobilis
WP_011251693  24 PDQEAVIAAIATVYDPEIPVNIYELGLIYAIDLHD-D-GRIHIEMTLTAPNCPSAQELPEMVRDVVSHVPGVTQATVEIV 101 Gluconobacter o...
WP_011689314   2 TVKDQIFAALKKVYDPEMPVNIVELGLIYGIEVDD-A-GQVDVRMTLTAPNCPVAGSLPAEAERAIRSVPGVTGVKLELT 79  Candidatus Soli...
WP_011540979  59 DLYEAVIAALKDIYDPEIPVNIYDLGLIYNVEIDE---GHVMVTMTLTTPHCPVAESMPGEVELRVGAVPGVGDAEVNLV 135 Sphingopyxis al...
WP_011584365  10 ELKNKALEAIQTVYDPEIPVNIFELGLIYEVSVFP-V-NNIFVQMTLTSPNCPAAQSMPAEVENKIKAIEGVNEVTVEIT 87  Cytophaga hutch...
WP_011485155  29 GLQARVIEALRGVFDPEIPVNIYDLGLVYGLDVDE-AlGKVHIRLTLTAPGCPVAQTFPEVVGSTVDGVPGVNEVEVELV 107 Polaromonas sp....
WP_011404134  38 DLYQRVVESLREIYDPEIPVNIYDLGLIYHLDVGE-D-SHVDVLMTLTAPNCPAAGVLPGQAEDAVRETEGVESVNLEMT 115 Salinibacter ruber
WP_011390319  34 asRDAVIDSLQEIYDPEIPVNIYDLGLIYEIEIDD-H-GDCKILMTLTAPACPVAGTLPGETAEKVATLEGIGRVEVNLT 111 Rhodospirillum ...
WP_012031155  98 WDPPWTMEMMSLRAKIDLNMI 118 Dichelobacter nodosus
WP_010946343 102 WEPPWSQDRMTEAARLELGIF 122 Legionella pneumophila
WP_011240342 124 WDPPWGMDRISDEAKLELGLL 144 Zymomonas mobilis
WP_011251693 102 WDPPWDMSRMSDDARLALNMF 122 Gluconobacter oxydans
WP_011689314  80 FDPPWTKARMSEAAKLACGIe 100 Candidatus Solibacter usitatus
WP_011540979 136 WDPPWSPANMSDEARLELGML 156 Sphingopyxis alaskensis
WP_011584365  88 FDPTWSQEMMSDAAKLELGFM 108 Cytophaga hutchinsonii
WP_011485155 108 WQPPWSKGMMSEAARLQLGLL 128 Polaromonas sp. JS666
WP_011404134 116 FEPPFSPQMMSEEARLELGFM 136 Salinibacter ruber
WP_011390319 112 WEPPWTPERMSEVARVALDMF 132 Rhodospirillum rubrum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap