Conserved Protein Domain Family

TIGR02944: suf_reg_Xantho 
FeS assembly SUF system regulator, gammaproteobacterial
The SUF system is an oxygen-resistant iron-sulfur cluster assembly system found in both aerobes and facultative anaerobes. Its presence appears to be a marker of oxygen tolerance; strict anaerobes and microaerophiles tend to have different FeS cluster biosynthesis systems. Members of this protein family belong to the rrf2 family of transcriptional regulators and are found, typically, as the first gene of a SUF operon. It is found only in a subset of genomes that encode the SUF system, including the genus Xanthomonas. The conserved location suggests an autoregulatory role. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other, Regulatory functions, DNA interactions]
PSSM-Id: 131989
Aligned: 4 rows
Threshold Bit Score: 197.337
Threshold Setting Gi: 56604555
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
tigr:MCA0993         81 DAIEGPIALTECSAEQALCQQSSSCDVRSHWNVINRAVQTTLESVSLADM 130 Methylococcus capsulatus str. Bath
AAM37779             81 EAMEGPLAITECSQDHSQCGIAQRCGVRSNWRLINDVVGDALRRVTLAQM 130 Xanthomonas axonopodis pv. citri str. 306
CAG45603             81 KCVEKDVNLTECCDLQKKCSLGN-CMVSGYWKVLNSQLLSLLSKTSIYDI 129 Francisella tularensis subsp. tularens...
AAM37779             81 EAMEGPLAITECSQDHSQCGIAQRCGVRSNWRLINDVVGDALRRVTLAQM 130 Xanthomonas axonopodis pv. citri str. 306
CAG45603             81 KCVEKDVNLTECCDLQKKCSLGN-CMVSGYWKVLNSQLLSLLSKTSIYDI 129 Francisella tularensis subsp. tularens...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap