Conserved Protein Domain Family
Sigma_B

?
TIGR02941: Sigma_B 
RNA polymerase sigma-B factor
This sigma factor is restricted to certain lineages of the order Bacillales including Staphylococcus, Listeria, and Bacillus.
Statistics
?
PSSM-Id: 131987
View PSSM: TIGR02941
Aligned: 3 rows
Threshold Bit Score: 427.009
Threshold Setting Gi: 13701859
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC12586   1 MTTKSQPHNKGGDEVYQWIEYLQKDpTNEEIQEKIVLKYQDLVGSIARKYSKNSAIHEDLVQVGMIGLLAAVRRYDPTYG 80  Oceanobacillus ihey...
BAB43151   2 AKESKSANEVSPEQINQWIKEHQEN-KNTDAQDKLVKHYQKLIESLAYKYSKGQSHHEDLVQVGMVGLIGAINRFDMSFE 80  Staphylococcus aure...
AAT53253   2 MEIQSQPTNLTKEDVIKLIAEFQQN-QCGEAQERLVDHYKNLVYSIAYRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIG 80  Bacillus anthracis ...
BAC12586  81 KSFESFAIPTIIGEIKRFIRDKTWSVHVPRRIKELGPKIRKGVDELTTDNQKSPTVAEIAKYIGTSEEEVLETMEMGQSY 160 Oceanobacillus ihey...
BAB43151  81 RKFEAFLVPTVIGEIKRYLRDKTWSVHVPRRIKEIGPRIKKVSDELTAELERSPSISEIANRLEVSEEEVLEAMEMGQSY 160 Staphylococcus aure...
AAT53253  81 NAFEPFAIPTIVGEIKKYLRDKTWGIHVPRRIKDLGGKIKLAIEELTDHLQRSPKIIEIADHLGLSEEEVLEIMDAKNNY 160 Bacillus anthracis ...
BAC12586 161 KALSVDRKIEADSDGSTVAILDLVGNSEDGYDNVEQRMMLEKILPILSEREQQILECTYFKNMSQKETGELLGISQMHVS 240 Oceanobacillus ihey...
BAB43151 161 NALSVDHSIEADKDGSTVTLLDIMGQQDDHYDLTEKRMILEKILPILSDREREIIQCTFIEGLSQKETGERIGLSQMHVS 240 Staphylococcus aure...
AAT53253 161 RVSSLDDVVENASDGSSVARIESVGEVEQGYEQTERRLVLKDIFNVLNETEKSVIHYIFEENLNQKDTGERLGISQMHVS 240 Bacillus anthracis ...
BAC12586 241 RLQRRSLRKLREAIQS 256 Oceanobacillus iheyensis HTE831
BAB43151 241 RLQRTAIKKLQEAAHK 256 Staphylococcus aureus subsp. aureus N315
AAT53253 241 RIKRQAISKLKQAAFL 256 Bacillus anthracis str. Sterne
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap