Conserved Protein Domain Family
RpoE_Sigma70

?
TIGR02939: RpoE_Sigma70 
RNA polymerase sigma factor RpoE
A sigma factor is a DNA-binding protein protein that binds to the DNA-directed RNA polymerase core to produce the holoenzyme capable of initiating transcription at specific sites. Different sigma factors act in vegetative growth, heat shock, extracytoplasmic functions (ECF), etc. This model represents the clade of sigma factors called RpoE. This protein may be called sigma-24, sigma-E factor, sigma-H factor, fecI-like sigma factor or alternative sigma factor AlgU.
Statistics
?
PSSM-Id: 131985
View PSSM: TIGR02939
Aligned: 4 rows
Threshold Bit Score: 332.184
Threshold Setting Gi: 504316924
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAI09235       1 MSDR-EIDQQLVERVQRGDKQAFGLLVTKYQRKLHRLLSRLIRDSAEVEDVAQETFIKAYRALGSFRGDSAFYTWLYRIG 79  Aromatoleum aro...
AAA65226       1 MSEQ-QTDQVLIERVQRGDKQAFNLLVIKYQNKVCNLVARYVSNSGDVPDVAQEAFIKAYRALPTFRGESAFYTWLYRIA 79  Photobacterium ...
WP_009561172  13 QEHGaPSDLLLVQRVQKGEKGAFDLLVRKYQHKVISLVGRFVRTPEEAEDVAQEAFVKAYRALANFRGDSAFYTWLYRIA 92  Acidithiobacill...
WP_014504026   5 DTPQ-ELDLELVRRVQRGESAAFDVLVRKYQHRIVALIGRYIADWSECQDVAQDTFVRAYRAISSFRGDAQFYTWLHRIA 83  Xanthomonas oryzae
CAI09235      80 INTAKNYLVSQSRRAPTSTgFDSEEAETFEEGDNLRDINTPERLMMTRQIGQTVDEAMEALPEELRTAIMLRELEGLSYE 159 Aromatoleum aro...
AAA65226      80 VNTAKNYLVAQGRRPPASD-VDAEDAEYYETGGALKEISNPENQMLSEELKRVVFGTIESLPEDLKTAISLRELDGLSYE 158 Photobacterium ...
WP_009561172  93 VNTAKNHLVAQGRQVSIVD-VETEDAEQFASADGLREYDTPEGLLLSRELAEYINKALTALPEDLRMAVTLREFEGLSYD 171 Acidithiobacill...
WP_014504026  84 VNTAKNHLVAHNRRPPTDD-IEISDAEHFDGATRLRDTDTPERELMRQELEQTVMRAVQALPEELRSAITLREVEGLSYE 162 Xanthomonas oryzae
CAI09235     160 EIASIMDCPIGTVRSRIFRAREAIAERLRPLL 191 Aromatoleum aromaticum EbN1
AAA65226     159 DIAEIMDCPVGTVRSRIFRAREAVEKRIRPLM 190 Photobacterium profundum
WP_009561172 172 EIAQVMECPVGTVRSRIFRAREAIARVLAPLL 203 Acidithiobacillus ferrooxidans
WP_014504026 163 DIARKMDCPIGTVRSRIFRAREAIDIELRPLL 194 Xanthomonas oryzae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap