Conserved Protein Domain Family

TIGR02939: RpoE_Sigma70 
RNA polymerase sigma factor RpoE
A sigma factor is a DNA-binding protein protein that binds to the DNA-directed RNA polymerase core to produce the holoenzyme capable of initiating transcription at specific sites. Different sigma factors act in vegetative growth, heat shock, extracytoplasmic functions (ECF), etc. This model represents the clade of sigma factors called RpoE. This protein may be called sigma-24, sigma-E factor, sigma-H factor, fecI-like sigma factor or alternative sigma factor AlgU.
PSSM-Id: 131985
Aligned: 4 rows
Threshold Bit Score: 332.184
Threshold Setting Gi: 504316924
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
CAI09235     160 EIASIMDCPIGTVRSRIFRAREAIAERLRPLL 191 Aromatoleum aromaticum EbN1
AAA65226     159 DIAEIMDCPVGTVRSRIFRAREAVEKRIRPLM 190 Photobacterium profundum
WP_009561172 172 EIAQVMECPVGTVRSRIFRAREAIARVLAPLL 203 Acidithiobacillus ferrooxidans
WP_014504026 163 DIARKMDCPIGTVRSRIFRAREAIDIELRPLL 194 Xanthomonas oryzae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap