Conserved Protein Domain Family
nifL_nitrog

?
TIGR02938: nifL_nitrog 
nitrogen fixation negative regulator NifL
NifL is a modulator of the nitrogen fixation positive regulator protein NifA, and is therefore a negative regulator. It binds NifA. NifA and NifL are encoded by adjacent genes. [Central intermediary metabolism, Nitrogen fixation, Regulatory functions, Protein interactions]
Statistics
?
PSSM-Id: 131984
View PSSM: TIGR02938
Aligned: 3 rows
Threshold Bit Score: 856.895
Threshold Setting Gi: 71846741
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P30663         22 LLPEIFRQTVEHAPIAISITDLKANILYANRAFRTITGYGSEEVLGKNESILSNGTTPRLVYQALWGRLAQKKPWSGVLV 101 Azotobacter vi...
tigr:MCA0763   16 LPSSLMRATVDQAPVAISITDLKANILYVNAAFSEITGYAPQECIGRNESMLSDRRTPPEVYQELWGCITRQQPWRGRLL 95  Methylococcus ...
jgi:Daro_1488  40 LPPEAYRQAVDQADLAISITDDKANILFANDAFTRVTGYTKEEIIGKNESVLSNHTTPPEVYQALWKSLAEQKPWAGKLL 119 Dechloromonas ...
P30663        102 NRRKDKTLYLAELTVAPVLNEAGETIYYLGMHRDTSELHELEQRVNNQRLMIEAVVNAAPAAMVVLDRQHRVMLSNPSFC 181 Azotobacter vi...
tigr:MCA0763   96 NRHRDGRRYLADLTVAPMLNEAGETTHFIGMHRDVTEEYLLQQQVRQQTLFLETVVASIPVSAVLIDENGRIVLDNLMYK 175 Methylococcus ...
jgi:Daro_1488 120 NRRKDGELYLAELSISPVVDATGTTTHFLGMHRNITELHRLERVVANQKHLIESVVDAAPVAFALLDPTGRVILDNQEYK 199 Dechloromonas ...
P30663        182 RLARDLVEDGSSESLVALLRENLAAPFETLENQGSAFSGKEISFDLGG-RSPRWLSCHGRAIHIENEQAHVFFAPTEERY 260 Azotobacter vi...
tigr:MCA0763  176 ALASDLKVEEPALLFLKLLREESGEDWNDFWHREKAFRNLELRFDPGGgRPSRWFSCAGQWFRHEEGSVDGFFSGSEKGY 255 Methylococcus ...
jgi:Daro_1488 200 KLVTDLRVKEPAHTVLDSLLPAWREALAEN-PQQLVVSNREARIDRAAgR-ARWLSVTSSVIGMHSDCADSYFCAAGQPG 277 Dechloromonas ...
P30663        261 LLLTINDISELRQKQQDSRLNALKALMAEEELLEGMRETFNAAIHRLQGPVNLISAAMRMLERRlGDKAGNDPVLSAMRE 340 Azotobacter vi...
tigr:MCA0763  256 LLLTVDDITQQKKQQEQYRLRGLQALMAEEEKLESLKETLFAAIHQIQGPLNLIGAAKNILDRR-GDDAGNVALRDLLQQ 334 Methylococcus ...
jgi:Daro_1488 278 LLLVIADVSNLREEQERARASALQAVLAEEERTAAIREGLSAAIFRLEEPMNVMSSAISVLQRR------DPASAAMLQQ 351 Dechloromonas ...
P30663        341 ASTAGMEALENLSGSIPVRMAESKMPVNLNQLIREVITLCTDQLLAQGIVVDWQPALRLPWVMGGESSQRSMIKHLVDNA 420 Azotobacter vi...
tigr:MCA0763  335 VMAAGEASICTLEKCIPHSDNNAFKPVNLNQVLHDAITLLTERLLASGIVVEWVPTPVLPSLKGSENRLRSLFKQLIENA 414 Methylococcus ...
jgi:Daro_1488 352 ALSGSREHMEALRQVIPQSPQEIVVSVNMNEILRDVLEVSTPRLLAAGIIVDWQPAATLPAILGRPLQLRMLFKALVDNA 431 Dechloromonas ...
P30663        421 IESMSQNqvSRRELFISTRVENHLVRMEITDSGPGIPPDLVLKVFEPFFSTKPPH-RVGRGMGLPVVQEIVAKHAGMVHV 499 Azotobacter vi...
tigr:MCA0763  415 IDAMAHS--RRRELRILTWTRDQLIHITIEDTGPGIPAGLRTQVFEPFFTTKASLgRQHVGMGLAVAHEIVNQHNGLIRI 492 Methylococcus ...
jgi:Daro_1488 432 IEAMNIKgwKRRELSLTSALNGDCIVVSVLDSGPGIPQDWRYKAFEPFFTAKGGS-GKHIGTGLSRAQQVVADHGGIIDL 510 Dechloromonas ...
P30663        500 DTDYREGCRIVVELPF 515 Azotobacter vinelandii
tigr:MCA0763  493 DPDYQEGCRIHMQFEI 508 Methylococcus capsulatus str. Bath
jgi:Daro_1488 511 DDSPSGGCAAIVEFRV 526 Dechloromonas aromatica RCB
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap