Conserved Protein Domain Family
TIGR02935

?
TIGR02935: TIGR02935 
probable nitrogen fixation protein
Members of this protein family, called DUF269 by pfam03270, are strictly limited to nitrogen-fixing species, although not universal among them. The gene typically is found next to the nifX gene (see TIGRFAMs model TIGR02663). [Central intermediary metabolism, Nitrogen fixation]
Statistics
?
PSSM-Id: 131981
View PSSM: TIGR02935
Aligned: 10 rows
Threshold Bit Score: 204.89
Threshold Setting Gi: 34483455
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC47013          13 DAPFLIELVKLWRAQDTNEAWEGKSDLDLLEPYILnrERRRALPIIGDPDPNTLWRLELFFNAVGLSVERETGIMVQPIL 92  Bradyrhizob...
CAE10453           2 EGVFKQALIDQFRALDAYGHWNRLSDEELLGRLYI--REKGASATCAEVDEATTRNIKLYYQALAVAFEKRCGEMANVMM 79  Wolinella s...
macrogen:ZMO1829   5 NSPFMRMLITRIRAEDSFGAWENKQDAALLSEYIVtkEERRAIPIIGDPDPEIIDRIDYFYQAVALAIEEKSGQMAVPIL 84  Zymomonas m...
jgi:Daro_1508     12 QTDFVKEMARQMRALDTYGTYQGWTVEKILDPYVLtkERKAEIPLIGDPDDETISRVKAFYNAIAVLIEKECKLLAVPLV 91  Dechloromon...
BAB52281          18 ASPFVKCLVRLIRAQDTHGSWDGTADAELLADFIVskERRRTIPIIGDPDPDVLWRLDKFYTAVALAIEERSGLMASPMI 97  Mesorhizobi...
CAE30054          13 DSLFVKELVKQLRAQDTHGVWEGKSDLKLLEPFIVdkAKRREIPIMGDPDPETLWRLELFYNAVALSIERETRIMVSPMM 92  Rhodopseudo...
P25015            15 ESPFLAQLVAVIRAEDSHGLWDDKTNSEILREFIVtaEERRSMPIIGDPDPELIWRMTKFYDAIGLLVEKRTGCMASQMQ 94  Rhodobacter...
ABA79707          15 ASDYLDQLAAIVRAQDSYGHWDGKSDAELLADYILtpEERREMPIISDPEPETIARIEKFYDAVGLLVEKRTGVMAGHMA 94  Rhodobacter...
BAE50370           7 QDPFIKNLCMFIRAQDMSGAWESMSDDDVLAPYILskEQRREIPLFGDPDPDILWRVEQYFNAIAMAIENKTGRAIAPIM 86  Magnetospir...
WP_011389938      16 ETPFVRQLVRQIRAEDTYGAWDGKPDAEVLGPFIVtaEQRREIPIIGDPDPDILWRLEIFYAAVGLTIEKATGRVASPIM 95  Rhodospiril...
BAC47013          93 KLHHEGFGRIVLIAGRLVAVNKQLRDVHRLGFDNCVKLAQEGDRYVSEGIGLIRKFPDVA 152 Bradyrhizobium diazoefficiens U...
CAE10453          80 ELNSEGYGRILVIVGRLIVLDKTIRDASKFGFGSLEELDKKGGGALGDALKAFEKYRSIF 139 Wolinella succinogenes
macrogen:ZMO1829  85 KLNHEGFGRLFVIVGRLVVLAKSMRDVHRFGFEDMAALNQEGCRAVDNAIKIIKQFPDAA 144 Zymomonas mobilis subsp. mobili...
jgi:Daro_1508     92 HLTHEGFGRALITVGKLVAVDRTLRDVHRFGFASLSKMKDEADKILSIAIERIGEHPAVA 151 Dechloromonas aromatica RCB
BAB52281          98 EMSHEGFGRVLFTAGRLVVLSKTVRDVHRFGFETFCKLAAAGTKLVDDAIAAIDAYPEVA 157 Mesorhizobium loti MAFF303099
CAE30054          93 KMHHEGFGRLILSAGRLIVINKHMRDVHRFGFDNLAKLAEEGDKLVAAGSEMIRKYPDVA 152 Rhodopseudomonas palustris CGA009
P25015            95 KMHHEGFGRVVLIAGKLVVVSKHLRDVHRFGFETWAKLAEAGEKLVESAVATINEFPEAA 154 Rhodobacter capsulatus
ABA79707          95 KFHHEGFGRVVLIGGSLVLVSKHMRDVHRFGFASYEKLAEAGEKLASAAVRKIEAHPEAA 154 Rhodobacter sphaeroides 2.4.1
BAE50370          87 KIHHEGWGRMILTAGKLVAVNSYMRELHRFGFDSVEAMSAKAQKLIDEGVATIEKYPDVA 146 Magnetospirillum magneticum AMB-1
WP_011389938      96 KMSHEGFGRMLLTTGKLVVINAYLRDIHRFGFPSLSKLAEKGAKLVAEGLAAIEAFPDAA 155 Rhodospirillum rubrum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap