Conserved Protein Domain Family
nifM_nitrog

?
TIGR02933: nifM_nitrog 
nitrogen fixation protein NifM
Members of this protein family, found in a subset of nitrogen-fixing bacteria, are the nitrogen fixation protein NifM. NifM, homologous to peptidyl-prolyl cis-trans isomerases, appears to be an accessory protein for NifH, the Fe protein, also called component II or dinitrogenase reductase, of nitrogenase. [Central intermediary metabolism, Nitrogen fixation]
Statistics
?
PSSM-Id: 131979
View PSSM: TIGR02933
Aligned: 4 rows
Threshold Bit Score: 355.693
Threshold Setting Gi: 49612391
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAG75841   6 RFSEWRLAQKMWNTTATQLPVDRQRLLQQQLARQLLLEQAVVEAAQNSLSTVTPDLVQAV----------TQELEPDLRQ 75  Pectobacterium atro...
CAA68024   8 RYSRWKLAKQMKLSEELNPTPAQYQQFIEAWQRQQVIEEAVAQAALEHALNIEPQSVEVT----------RQALAAELPE 77  Pantoea agglomerans
P0A3Y9     6 RFARQRLARSRWNRDPAALDPADTPAFEQAWQRQCHMEQTIVARVPEG--DIPAALLENI----------AASLAIWLDE 73  Klebsiella pneumoniae
P14890    12 RYYLLKVAHEQFGCAPGELSEDQLQQADRIIGRQRHIEDAVLRSPDAIGVVIPPSQLEEAwahiasryesPEALQQALDA 91  Azotobacter vinelandii
CAG75841  76 SGFSASDRTAVIQHHVLMAGQLASISEQVAVPTSAEVEQWYRRHAARFCRPEQRLTRHLLLTTgED----DSEAISRQLL 151 Pectobacterium atro...
CAA68024  78 LELTATETEELLLHQTLLREQLNWVQQQAPQPDDAQVEAWYRGHAQHFVRPEQRYTRHLLLTV-EG----NSPAVREQID 152 Pantoea agglomerans
P0A3Y9    74 GDFAPPERAAIVRHHARLELAFADIARQAPQPDLSTVQAWYLRHQTQFMRPEQRLTRHLLLTV-DN----DREAVHQRIL 148 Klebsiella pneumoniae
P14890    92 QALDAAGMRAMLARELRVEAVLDCVCAGLPEISDTDVSLYYFNHAEQFKVPAQH-KAHILVTInEDfpenTREAARTRIE 170 Azotobacter vinelandii
CAG75841 152 ALRRQLQSDTAAFATLAERHSQCPTALEGGLLGWVSRGLLFTSLDQALFTLHEGELSAIIETDIGWHLLLCEAIRPETPM 231 Pectobacterium atro...
CAA68024 153 AIARRLRDGHALFARQALRYSHCPSAMGGGVLGWVGRGILYPQLEDTLFRLEAGQLSSPVETELGWHLLLCEQIRLPQPL 232 Pantoea agglomerans
P0A3Y9   149 GLYRQINASRDAFAPLAQRHSHCPSALEEGRLGWISRGLLYPQLETALFSLAENALSLPIASELGWHLLWCEAIRPAAPM 228 Klebsiella pneumoniae
P14890   171 TILKRLRGKPERFAEQAMKHSECPTAMQGGLLGEVVPGTLYPELDACLFQMARGELSPVLESPIGFHVLYCESVSPARQL 250 Azotobacter vinelandii
CAG75841 232 AQEDALAKAYDHLLLQRQKEQQRQWLVQLV 261 Pectobacterium atrosepticum SCRI1043
CAA68024 233 PKAEALTRVRQQLIARQQNHYQRQWLQQLI 262 Pantoea agglomerans
P0A3Y9   229 EPQQALESARDYLWQQSQQRHQRQWLEQMI 258 Klebsiella pneumoniae
P14890   251 TLEEILPRLRDRLQLRQRKAYQRKWLVCLL 280 Azotobacter vinelandii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap