Conserved Protein Domain Family
vnfK_nitrog

?
TIGR02932: vnfK_nitrog 
V-containing nitrogenase, beta subunit
Nitrogenase is the enzyme of biological nitrogen fixation. The most wide-spread and most efficient nitrogenase contains a molybdenum cofactor. This protein family, VnfK, represents the beta subunit of the vanadium (V)-containing alternative nitrogenase. It is homologous to NifK and AnfK, of the molybdenum-containing and the iron (Fe)-only types, respectively. [Central intermediary metabolism, Nitrogen fixation]
Statistics
?
PSSM-Id: 131978
View PSSM: TIGR02932
Aligned: 4 rows
Threshold Bit Score: 871.466
Threshold Setting Gi: 75703956
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAE26823       5 VISKERVGVINPMYDCQPAGAQYAGIGVKDCIPLVHGGQGCTMFVRLLFAQHFKENFDIASTSLHEDSAVFGGHQRIIDG 84  Rhodopseudomona...
P16856        16 LSPRDREGIINPMYDCQPAGAQYAGIGIKDCIPLVHGGQGCTMFVRLLFAQHFKENFDVASTSLHEESAVFGGAKRVEEG 95  Azotobacter vin...
jgi:Ava_4027   5 VNKKERAGVINPIFTCQPAGAEYATIGVKDCIPLVHGGQGCSMFVRLIFAQHLKENFDIASSSLHEASAVFGGMPRIEEG 84  Anabaena variab...
AAM04637       5 LMLKERTGIINPMYTCQPAGAQYAGIGVKDCIPLVHGGQGCSMFVRLLFAQHFKENFDIASSSLHESAAVFGGAIRVEEA 84  Methanosarcina ...
CAE26823      85 VLTLARRYPELRVIPVITTCSTEIIGDDIEGNIGKANAALKKEFPGRKIHVVPVHTPSFKASQVGGYAECMQAIIKTI-- 162 Rhodopseudomona...
P16856        96 VLVLARRYPNLRVIPIITTCSTEVIGDDIEGSIRVCNRALEAEFPDRKIYLAPVHTPSFKGSHVTGYAECVKSVFKTItd 175 Azotobacter vin...
jgi:Ava_4027  85 VKTLVARYPDLRLIPIITTCSTETIGDDVEGTINKVNKFLKKEYPNREVKLIPVHTPSYRGSQVTGYDAGVTSLITNL-- 162 Anabaena variab...
AAM04637      85 VETLIARYPHLRIIPIITTCSTETIGDDIEGIIRKVNQKIKENHPDRDVKLVAIHTPSYSGSMVTGYDNAISAMVKAL-- 162 Methanosarcina ...
CAE26823     163 CDHKVAPTGKLNVFPGWVNPGDVVLLKHYFNEMGVDATIFMDTEDFDSPMLPDKSIHTHGRTTVEDIKHASGAIASLALA 242 Rhodopseudomona...
P16856       176 AHGKGQPSGKLNVFPGWVNPGDVVLLKRYFKEMDVEANIYMDTEDFDSPMLPNKSIETHGRTTVEDIADSANALATLSLA 255 Azotobacter vin...
jgi:Ava_4027 163 -AKKGEPNGKLNIITGWVNPGDVTEVKHILSEMGVDANILLDTETFNAPTMPDKNSFTFGNTTIEDIAGSANAIGTIALC 241 Anabaena variab...
AAM04637     163 -AKKGEPSEKLNIFTGWVNPGDVSEIKHILSEMQVDGNILLDTETFDSPIMPDKSAFAYGNTTIEDIADSANALGSIALS 241 Methanosarcina ...
CAE26823     243 KYEGGSTADYLKTEFEVPSHLVSTPYGIANTDAMLKRISEITGKPIPDSLVKERGIALDALQDLAHMFFADKKVALFGHP 322 Rhodopseudomona...
P16856       256 RYEGNTTGELLQKTFAVPNALVNTPYGIKNTDDMLRKIAEVTGKEIPESLVRERGIALDALADLAHMFFANKKVAIFGHP 335 Azotobacter vin...
jgi:Ava_4027 242 KYEGGNAAKFLQEQFDVPAIVGPTPIGIKNTDAWLQNIKKLTGKPIPESLVVERGKAIDSLADLAHMYFANKRVAIYGDP 321 Anabaena variab...
AAM04637     242 RYEGANAATFLKEKFDVPSIVTPTPIGINNTDIFLKNISELTGKPIPESLVIERGKAIDSIVDLAHMFFANKKVAIFGNP 321 Methanosarcina ...
CAE26823     323 DLVIGLAEFCLEVEMKPVLMLLGDDN-SRYKKDPRILALKNKCN---WDMEVVCNADLWELEKRALDKDyGIDLIMGHSK 398 Rhodopseudomona...
P16856       336 DLVLGLAQFCMEVELEPVLLLIGDDQgNKYKKDPRIEELKNTAH---FDIEIVHNADLWELEKRINAGL-QLDLIMGHSK 411 Azotobacter vin...
jgi:Ava_4027 322 DLVIGLAEFCLEVELEPVLLLLGDDN-QAASKDPRLAELAKRANhaeYDIDVIWNADLWELESRVKEKG-DIDLILGHSK 399 Anabaena variab...
AAM04637     322 DLVFGLAQFCLECELEPVLLLLGDDN-SSYKKDPRLKELEEKTN---CDMQIIWNADLWELESRIKNKTiDVDLILGHSK 397 Methanosarcina ...
CAE26823     399 GRYVAIDANIPMVRVGFPTFDRAGLYRHPTMGYRGAMLLGETIANTLFAHMEYNKDREWLLNTW 462 Rhodopseudomonas palustris CGA009
P16856       412 GRYVAIEANIPMVRVGFPTFDRAGLYRKPSIGYQGAMELGEMIANAMFAHMEYTRNKEWILNTW 475 Azotobacter vinelandii
jgi:Ava_4027 400 GRYIAIDNKIPMVRVGFPTFDRAGLWKNPVIGYRGAEWLGDAIANAMFADMEYKHDREWILNVW 463 Anabaena variabilis ATCC 29413
AAM04637     398 GRYIAIDNDIPMVRVGFPTFDRAGLWKYPVIGYKGAEWLAENIANTIFASMENKHDREWIINVW 461 Methanosarcina acetivorans C2A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap