Conserved Protein Domain Family
anfK_nitrog

?
TIGR02931: anfK_nitrog 
Fe-only nitrogenase, beta subunit
Nitrogenase is the enzyme of biological nitrogen fixation. The most wide-spread and most efficient nitrogenase contains a molybdenum cofactor. This protein family, AnfK, represents the beta subunit of the iron-only alternative nitrogenase. It is homologous to NifK and VnfK, of the molybdenum-containing and the vanadium (V)-containing types, respectively. [Central intermediary metabolism, Nitrogen fixation]
Statistics
?
PSSM-Id: 131977
View PSSM: TIGR02931
Aligned: 4 rows
Threshold Bit Score: 939.322
Threshold Setting Gi: 19915046
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P16267     2 TCEVKEKGRVGTINPIFTCQPAGAQFVSIGIKDCIGIVHGGQGCVMFVRLIFSQHYKESFELASSSLHEDGAVFGACGRV 81  Azotobacter vinelandii
Q07935     2 TCQVTQKAREGTINPIFTCQPAGAQFASIGIKDCIGIVHGGQGCVMFVRLLISQHMKESFEIASSSVHEDGAVFGALDRV 81  Rhodobacter capsulatus
CAE26878   2 NCQFKPKDRIGTINPIFTCQPAGAQYASIGIKDCIGIVHGGQGCVMFVRLLISQHLKESFEIASSSVHEDGAVFGALDRV 81  Rhodopseudomonas pa...
AAM04627   2 SCELKERERPGIINPIFTCQPCGAQYASIGIKDCIAIVHGGQGCVMFVRMLLAQHFKDSFEIASSSLHEDGAVFGALNRV 81  Methanosarcina acet...
P16267    82 EEAVDVLLSRYPDVKVVPIITTCSTEIIGDDVDGVIKKLNEGLLKEKFPDREVHLIAMHTPSFVGSMISGYDVAVRDVVR 161 Azotobacter vinelandii
Q07935    82 ETAVEVLLTRYPDVKVVPIITTCSTEIIGDDVDGLLSKLEDELLPTKFPGREVHLLTVHCPSFVGSMITGYDKAVHDFVK 161 Rhodobacter capsulatus
CAE26878  82 EEAVDVLLMRYPHVKVVPIITTCSTEVIGDDVDGVVTKLQEELLDVKYPDREVHLIPIHCPSFVGSMVTGYDVAVRDFVK 161 Rhodopseudomonas pa...
AAM04627  82 EEAVDVLLTRYPRVKVVPIITTCSTEVIGDDIDGLIRKLNKKLLKEKYADREVHLIPIHTPSFKGSMVTGYDVAVHDIVK 161 Methanosarcina acet...
P16267   162 HFAKREAPNDKINLLTGWVNPGDVKELKHLLGEMDIEANVLFEIESFDSPILPDGSAVSHGNTTIEDLIDTGNARATFAL 241 Azotobacter vinelandii
Q07935   162 KFATKDEPSDKINLITGWVNPGDVKELKHLLEVMEVKANVLFEVESFDSPLMPDLEHHSHGSTTIEDLRDTANAKGTIAL 241 Rhodobacter capsulatus
CAE26878 162 HFSKKDKPSLKINLITGWVNPGDVKELKHLLAEMQVEANVLFEIESFDSPLMPDKSAVSHGSTTIADLTATADAQGTIAL 241 Rhodopseudomonas pa...
AAM04627 162 EFAKKDKPNGKINLITGWVNPGDVTALKHLLSAMDIDATVLFEIESFDSPLMPDKSGVAHGSTTIEDLTGTANATGTIAL 241 Methanosarcina acet...
P16267   242 NRYEGTKAAEYLQKKFEIPAIIGPTPIGIRNTDIFLQNLKKATGKPIPQSLAHERGVAIDALADLTHMFLAEKRVAIYGA 321 Azotobacter vinelandii
Q07935   242 NRYEGMKAADYLKKKFKVPAVIGPTPVGIRNTDAFLKAVSEMTGQPIPAQLVKERGLALDAIADIGHMFLADKRVAIYAN 321 Rhodobacter capsulatus
CAE26878 242 NRYEGGLAATWLQTRWDVPAVIGPTPIGIRNTDTFLRNVKEMTGKPIPESLVKERGIALDAITDLAHMFLADKKVAIYGN 321 Rhodopseudomonas pa...
AAM04627 242 NRYEGAKAAKYLESEFDVPAIIGPTPIGIRNTDTFLQNLKKMTGKPIPESLVCERGIAIDAITDLTHMFFADKKVAIYGN 321 Methanosarcina acet...
P16267   322 PDLVIGLAEFCLDLEMKPVLLLLGDDNSKYVDDPRIKALQENVDyGMEIVTNADFWELENRIKnEGLELDLILGHSKGRF 401 Azotobacter vinelandii
Q07935   322 PDLAIGLTEFCLDLEMKPKLLLLGDDNSGYVKDPRVVALQENAP-DLEIVTNADFWDLESRIQ-QGLELDLILGHSKGRF 399 Rhodobacter capsulatus
CAE26878 322 PDLVLGLAEYCLDLEMKPVLLLLGDENAGYANDPRIAALKANVDyPMEIITNADLFELEERIKnG-LELDLILGHSKGRF 400 Rhodopseudomonas pa...
AAM04627 322 PDLVIGLAEFCLDMEMKPMVLLLGDDNKTYPDDPRIKELQEKVDfDMEIIMNADMWELERRIKdKEIELDLIMGHSKGRW 401 Methanosarcina acet...
P16267   402 ISIDYNIPMLRVGFPTYDRAGLFRYPTVGYGGAIWLAEQMANTLFADMEHKKNKEWVLNVW 462 Azotobacter vinelandii
Q07935   400 ISIDYKVPMVRVGFPTYDRAGMYRHPVLGYGGAMFLAETMANTLFADMEAKKNKEWILNVW 460 Rhodobacter capsulatus
CAE26878 401 VAIDYNIPMLRVGFPTYDRAGLYRYPVVGYAGATWLAEQMANTLFNDMEVKKNREWILNVW 461 Rhodopseudomonas palustris CGA009
AAM04627 402 TAIDNNIPMVRVGFPTFDRAGMYRHPVVGYEGAIWLAEQMANTLFADMEYKKDREWILNVW 462 Methanosarcina acetivorans C2A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap