Conserved Protein Domain Family
vnfG_nitrog

?
TIGR02930: vnfG_nitrog 
V-containing nitrogenase, delta subunit
Nitrogenase is the enzyme of biological nitrogen fixation. The most wide-spread and most efficient nitrogenase contains a molybdenum cofactor. This protein family, VnfG, represents the delta subunit of the V-containing (vanadium) alternative nitrogenase. It is homologous to AnfG, the delta subunit of the Fe-only nitrogenase. [Central intermediary metabolism, Nitrogen fixation]
Statistics
?
PSSM-Id: 131976
View PSSM: TIGR02930
Aligned: 4 rows
Threshold Bit Score: 190.422
Threshold Setting Gi: 19915056
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAM04636   4 KIEEITALIQERCLWQFFSRSWDREENIEGIMTMTGKILNGEKINLVTPADKAFYSDAKNLAADIQNKMPWISELDKSGI 83  Methanosarcina acet...
CAA52044 479 KVTNITTYIQERCLWQFHSRAWDREENINGVIKKAAELLSGERSVQETLTDKLHYADAKILVSELKRNLPWIKELDKAQV 558 Anabaena variabilis
AAD40077   4 RVEQLYQYIEERCLWQFFSRTWDREENIEGVLNQFGRLMTGEAPLKETPMDRLFYADALPIANDCRERFDWAATITKDDI 83  nitrogen-fixing bac...
CAE26822   5 QIDQLYNYCQERYLWQFFSRTWDRQENIDNIVATATSLFNGEVVKRETPMEKLFYSDAIVMVSDFKERFPWILDCSPDQI 84  Rhodopseudomonas pa...
AAM04636  84 LELVEGVKKRLLHITVKKSRNCELNLPNY 112 Methanosarcina acetivorans C2A
CAA52044 559 KSVLESVKQNLVGIAIAGSLNGELHHSLY 587 Anabaena variabilis
AAD40077  84 AELIASIKGQLVENTITRSTNRELSHHLY 112 nitrogen-fixing bacterium SM2
CAE26822  85 RELMAGLKDRLTEIAITRSLNGELNHSLY 113 Rhodopseudomonas palustris CGA009
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap