Conserved Protein Domain Family
anfG_nitrog

?
TIGR02929: anfG_nitrog 
Fe-only nitrogenase, delta subunit
Nitrogenase, also called dinitrogenase, is the enzyme of biological nitrogen fixation. The most wide-spread and most efficient nitrogenase contains a molybdenum cofactor. This protein family, AnfG, represents the delta subunit of the Fe-only alternative nitrogenase. It is homologous to VnfG, the delta subunit of the V-containing (vanadium) nitrogenase. [Central intermediary metabolism, Nitrogen fixation]
Statistics
?
PSSM-Id: 131975
View PSSM: TIGR02929
Aligned: 3 rows
Threshold Bit Score: 195.528
Threshold Setting Gi: 6277251
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAA86282  16 KMKQLEWYITKHCLWQYNSRGWDREIQNERILMKTRQILCGENAREDNSyADRYYWSEAITLAGAFKRYFPWLEDMTKDE 95  nitrogen fixing bac...
O68940     8 RIDLLIDYIMKHCLWQFHSRSWDRKRQNEGILTKTTQLLCDEPVDLGTP-ADKCYWVDAVCLADAYKSRYPWLKTMDKDD 86  Rhodospirillum rubrum
Q07934     7 KLDPLVDYIMKNCLWQFNSRGWDRLKQNAGILSQTCEILCGEEPVHETA-MDRCYWVDAVILSRAYKARFPWLMAMTKPE 85  Rhodobacter capsulatus
BAA86282  96 IATVMQMLKEKMDYTMIKGSLNLELTKEKY 125 nitrogen fixing bacterium ANFK33
O68940    87 IKALMGALHERLDHLTITGSLNLELTDQHY 116 Rhodospirillum rubrum
Q07934    86 IKSLFKALHEKIDHLTVHGSLNTELTVPHY 115 Rhodobacter capsulatus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap