Conserved Protein Domain Family
AhaH

?
TIGR02926: AhaH 
ATP synthase archaeal, H subunit
he A1/A0 ATP synthase is homologous to the V-type (V1/V0, vacuolar) ATPase, but functions in the ATP synthetic direction as does the F1/F0 ATPase of bacteria. The hydrophilic A1 "stalk" complex (AhaABCDEFG) is the site of ATP generation and is coupled to the membrane-embedded proton translocating A0 complex. It is unclear precisely where AhaH fits into these complexes.
Statistics
?
PSSM-Id: 131972
View PSSM: TIGR02926
Aligned: 6 rows
Threshold Bit Score: 41.7547
Threshold Setting Gi: 76557025
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:MbarA_0392   7 LSEIKKAEESAKSVVDEAIEAKNRRISEARAEAREILKQAEIDAHKAAQDSFKEGEKKILEERDKIITDGEKNALAMSQK 86  Methanosarcin...
O29107          10 LEKIKQAEIKVEEAIRAAEEERKNKILEAKMKAREIIESAEAEAVKVKEDILNSARQQIEAEKEEIRKRETKNIEDYAKK 89  Archaeoglobus...
CAI48600         7 LEQIKEAEGEADDIVAEAEQEREERIAEAREEADSIREEAQEEAQQLKQERLEEAREEIEAEREDILAEGESEREALESR 86  Natronomonas ...
AAL80300         5 LREIVKAERLAEERIEAAKVEAKKIIQNAREEAKKLEEEILKKAEEEGKRIIESKKAEGEQEAKKIREEGEKEIEELKVK 84  Pyrococcus fu...
Q57676           9 IKEVKLAEEQAVKEIEEAKNRAEQIKAEAIEEAKKLIAEAEEEAKKLVEEMIKKAEEEAKKEAEKILEETEKEIKEIISI 88  Methanocaldoc...
AAB85457        11 ITTIKKAENDADRLIQEAREKSSQLLDDARNRSAELLEKAEREASEKGDEIIAEAEERARKEAIEISGKAKREVETMKSA 90  Methanothermo...
jgi:MbarA_0392  87 AQANI 91  Methanosarcina barkeri str. Fusaro
O29107          90 GKDNI 94  Archaeoglobus fulgidus DSM 4304
CAI48600        87 AEENR 91  Natronomonas pharaonis DSM 2160
AAL80300        85 AEEKF 89  Pyrococcus furiosus DSM 3638
Q57676          89 AKVKI 93  Methanocaldococcus jannaschii DSM 2661
AAB85457        91 AMGKV 95  Methanothermobacter thermautotrophicus str. Delta H
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap