Conserved Protein Domain Family
cis_trans_EpsD

?
TIGR02925: cis_trans_EpsD 
peptidyl-prolyl cis-trans isomerase, EpsD family
Members of this family belong to the peptidyl-prolyl cis-trans isomerase family and are found in loci associated with exopolysaccharide biosynthesis. All members are encoded near a homolog of EpsH, as detected by TIGR02602.
Statistics
?
PSSM-Id: 131971
View PSSM: TIGR02925
Aligned: 5 rows
Threshold Bit Score: 312.898
Threshold Setting Gi: 74057311
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
tigr:CT0711      4 ITSLFFVLLFAILVGCSEKSAQESNSGVAAVVNGVEITNRQIDYFYQRTAMPGMSAe-DSANLKRRILSDLIRIELLAGK 82  Chlorobium te...
jgi:Nmul_A0241  16 ITPLLLPLLVLGLAACDKKESSQPASQVAAKVNSGEISVHQLNYVLARATRNSANSpeNASRIRREVLDRLVDQELAVEQ 95  Nitrosospira ...
jgi:Tbd_1798     9 VSLVLAALVTGCGDKKEEAAADKPASQVAAKVNGTELTVHQVNYALQRIPNLDKDQ---AKPASLQVVRNLVDQELVVQR 85  Thiobacillus ...
BAC55134         4 MKKAVFVAMVVALAACGKSEEKSSSGQVAAIVDGKEISVLQLNQAMKNMPNVTADN---ADAVRKQLLDRLVDQQVVLNK 80  Methylobacill...
WP_011397245     9 PKFVFLAALTGSLAGCGGAGEATDATQVVAKVNGSEISIHQLNAILAKQPAQGVSS--DTARAR--ALDELVEQQVAYDK 84  Hahella cheju...
tigr:CT0711     83 AKEMKLDNNPDYSMALYAAQKNVLAGLAERKLAGNQAPVTPDQAESVVQNAPQLFAGRKLYVFEEVIFPgVDMPLLESLD 162 Chlorobium te...
jgi:Nmul_A0241  96 AINKKLDRSPEVLMALDNARREILARAYLEQITAATPKPTVEEAKTYYSEHPQLFAERRIYNIQEIVLP-SSAGVADELR 174 Nitrosospira ...
jgi:Tbd_1798    86 ALEEKLDRDPRVVQAVDSARRQILAEAYMARKLGTPSEPSDGEISEYFNSHPEMFAQRKIYRLQEVSIQ-APKEKHDAIR 164 Thiobacillus ...
BAC55134        81 ALEEKVERSAEVISSIEAAKREIITRAYLTNMVSSRIKPSPQQVKAYFDGHPELFSARKVYNLQDIALP-PGTAIPDELK 159 Methylobacill...
WP_011397245    85 AVELKLDRSPDVVMAIESMKKSIIARAYLQQVIGALSQPSQEEIHQYYQEHPALFAERKLYSLQEIAIE-PRDELLAPLR 163 Hahella cheju...
tigr:CT0711    163 AMATNGAPLSGLLDELKAKKKPFNSSLKALTSEQLPAPILAVLNKLKPNTPQVVRSGDKVsVILVLHDAIPAPLEG 238 Chlorobium tepidu...
jgi:Nmul_A0241 175 EMLDSGKPMEDIAKWLKGKDIKFAAGSATRSAEQIPLEILPKIHPLKPGQGLLIQGPQSI-TLMRIAAAQTAPITE 249 Nitrosospira mult...
jgi:Tbd_1798   165 KQLEASKTLNDFLAWLKAENLPAKVGQAVKPAEQLPAAVLPKLAQMPNGQALVANAPNGL-LVLVVADSQAQPVTL 239 Thiobacillus deni...
BAC55134       160 ALVERSKGLQEVAEWLKSQNVKFGASSYSRPAEQVPTDALAVLKDQKDGAVLIVPMDGNP-HIVKLIGAIVSPNAL 234 Methylobacillus s...
WP_011397245   164 NKVGNAGQLEDIVAWLKAEGVQYRVNAANRSAEQIGLELLTQVARLEDGAMTLFQGPNNY-LVVRVAASQKRPVSE 238 Hahella chejuensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap