Conserved Protein Domain Family
PEP_integral

?
TIGR02921: PEP_integral 
PEP-CTERM family integral membrane protein
Members of this protein family, found in eighteen genera so far, have a PEP-CTERM sequence at the carboxyl-terminus (see model TIGR02595), but are unusual among PEP-CTERM proteins in having multiple predicted transmembrane segments. The function is unknown. It is proposed that an exosortase (see TIGR02602), recognizes and cleaves PEP-CTERM proteins in a manner analogous to the cleavage of LPXTG proteins by sortase (see Haft, et al., 2006). In at least six species, a gene encoding what appears to be a dedicated (single target) exosortase is adjacent. In that subset, the PEP-CTERM motif takes the form VPEPxxWxL.
Statistics
?
PSSM-Id: 131967
View PSSM: TIGR02921
Aligned: 2 rows
Threshold Bit Score: 1637.84
Threshold Setting Gi: 17130737
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAB73347       9 VKSFWNASFEGIFWLWNLTFLSLVYLGILPFVGVPLVLATARGDIPIEFSLALVTLIAVPTISSIIGGWCFLQQPVKLIR 88   Nostoc sp. PCC...
WP_011400191   6 LPGWLAVCCYLLFWFWNLTYAVLTGVLIVPFFTLPAISGAFIGLHSWMTAVFSILLVAIPALCIGLGLTRFRKNPTALIK 85   Hahella chejue...
BAB73347      89 LFYGVEAPLFVLCLLRLFLIRELTPASSQILLTMGVCIAAFAGELFWGYASRRKIglqWVQMLAHTLMLVFGIYAGAVLL 168  Nostoc sp. PCC...
WP_011400191  86 LFYGVEMPIIFIMLSTLFLLRELNPGVTHVLINILIALFAYLACLWGGVNTRFPM---WLRLSLAMTMLLTGLYCALLLA 162  Hahella chejue...
BAB73347     169 FYALPLAV--FLLQELVKFEWVIPLWN-ILYHTAFVGGLfiismwlivlaFSATLFILMPSALTAMYVHSGAKILKAFAS 245  Nostoc sp. PCC...
WP_011400191 163 QFFIPATAgfFELLGEIELRHLGDIFNyLLFLVALICGL-----------STCVVFLALPFVLTFLYIREFLREWRIADA 231  Hahella chejue...
BAB73347     246 EHGNKKAFAGASAVIVAFAVTFLSLQQQPQVMAFSLLANAPKNDSDRQTLIT----KSEQIRTGLLNAYLSSYRYLSSRE 321  Nostoc sp. PCC...
WP_011400191 232 SLGRAKAGAVAAGILALNALLFAVLNQQPQQETFERMAFLDQRFQPGETIPSipreEHDALRKGLINAYLAPYRYLSTTE 311  Hahella chejue...
BAB73347     322 ENNHISAMYRHVL-GLEKTAADGLQETYNFLMSPFLYNGS--DKDVAKAEKLYAEFFDTPLQKAEKTAVSHAVQSTFNEQ 398  Nostoc sp. PCC...
WP_011400191 312 RNGAVFNAYLGAFdSADHSLAKGSQAIFNFLATPFLYDGAyfREDKERAARYYRAFFDQPIEKGEPEAILHAIQATFDQG 391  Hahella chejue...
BAB73347     399 EVKAGLLNINEKKVLLASQQVTVKEHGDWADVELYEVYKNQTPEVQEVFYSFSLPESAVITGLWLGDTNKLDQRFNFVVS 478  Nostoc sp. PCC...
WP_011400191 392 QPVAGLLDVLNRYVLITNMAITVEPQGDNARIRIVQTLENQTYNNHEVTFHFSLPEEAALTGLWLSDDAKDLDKFAYALA 471  Hahella chejue...
BAB73347     479 PRGAAQKVYNSQVRRErpVDPALLEQVGPRHYRLRAFPIPP------NNVQQIEGQPPLPTEMNLWLTYKVLGQDKG-WA 551  Nostoc sp. PCC...
WP_011400191 472 PRGAAQQVYNDEVQQR--IDPSLLEQVGPRQYRLRAFPVPPrranynRSMGLLLGTDYEVDPMYLTFEYKTTINDQGaWP 549  Hahella chejue...
BAB73347     552 MPDLGERRNIFWTNQTKRIRNGKEIGFKENAWLEEFIPASQKIQPALHEVSLdEGYKILAKPLSNKD--YTLPKN-QRVA 628  Nostoc sp. PCC...
WP_011400191 550 LPQLLEKRNAYWSDQTQRTLNDQPLQTEKDAWLPITAQMSAAAPRKQHDAVV-AGQRVRAVPRTGADaqWDIQKStTPYA 628  Hahella chejue...
BAB73347     629 LVLDTSRSMGEHIKELTQTLSWLKQHGFADNDLTNNDADLYISVSPGATptrldnlqqfqpekvAFYGTIQPQEMLAQFN 708  Nostoc sp. PCC...
WP_011400191 629 ILIDGSYSMGEQAGNVTTALKQLQQLDVAHEIFLCRERCQSITAPPSAD---------------EFYGDSLPMNQLAAWR 693  Hahella chejue...
BAB73347     709 NlRGDTAYDAVLLLSDEGSYELSKNNKTVPATPAPLWMVHLGG-LPGAYNDGIIKSLQDSGGGVAVDIAEVL--QRIATK 785  Nostoc sp. PCC...
WP_011400191 694 R-KVKQNYDAVVLLTDAGSYELESQFTLKADQMPPVWLVHLGEtLAYAYHDKTLDLLKQSHGGVALSLQEAIaaHQFRQK 772  Hahella chejue...
BAB73347     786 SILGDSVVTVVNGYAWYLQT---LDTAVTTNNQQDDLLP-LAARQLILGLSKQIKLDNLKSLDAIHAVAKKYKIVSPYSS 861  Nostoc sp. PCC...
WP_011400191 773 RATDTGLFAVTQHYLWYAEAgadAEAVLSNAKTEADFFSaIAARRWLEYLAQTRDVSDVKVLDELHAIAKAEHLVTDYSS 852  Hahella chejue...
BAB73347     862 MLVLVNDEQRQLLKEAEAASDRFDRKVENGKENLSKPNNPLKVS-VPEPSGGWLLGVSAIAL--FIFAKRRR 930  Nostoc sp. PCC 7120
WP_011400191 853 MIVLVEERQKKALEEAEQKADRFDREVETGQETFSAPMDMFSASpVPEPEEWILLGLAGLMLgfAVLNRKRR 924  Hahella chejuensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap