Conserved Protein Domain Family
acc_sec_Y2

?
TIGR02920: acc_sec_Y2 
accessory Sec system translocase SecY2
Members of this family are restricted to the Firmicutes lineage (low-GC Gram-positive bacteria) and appear to be paralogous to, and much more divergent than, the preprotein translocase SecY. Members include the SecY2 protein of the accessory Sec system in Streptococcus gordonii, involved in export of the highly glycosylated platelet-binding protein GspB. [Protein fate, Protein and peptide secretion and trafficking]
Statistics
?
PSSM-Id: 131966
View PSSM: TIGR02920
Aligned: 5 rows
Threshold Bit Score: 412.977
Threshold Setting Gi: 41582763
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
tigr:SP_1763   8 IAVKKGLFTSFLLFIYVLGSRIILPFVDLNTkdFLGGSTAYLAFSAALTGGNLRSLSIFSVGLSPWMSAMILWQMFSFSK 87  Streptococcus p...
CAD47181      11 IILRKILITFSLIIIFLLGRYVPIPGVLISA--YKGQDNNFATLYSTVTGGNLSQVGVFSLGIGPMMTTMILLRLFTIGK 88  Streptococcus a...
AAS08374       8 NVIKKVSFSLFIVIIYVMGLYIPLPFAEGTKqyMEAVKNTPISILGAFSGANFTRISIFSIGLNPLMFSMLIIQLLSFTH 87  Lactobacillus j...
BAB43751      12 IIYKRMLYTCFILFIYILGTNISI----VSYndMQVKHESFFKIAISNMGGDVNTLNIFTLGLVPWLTSMIILMLISYRN 87  Staphylococcus ...
tigr:SE2280    9 ILYKRIFFTCLILVIYIIGSNISI----VSNenLRTHKDSFFKLAITNVGGDLHTLNIFSLGLGPWLSSMIILTLINHKS 84  Staphylococcus ...
tigr:SP_1763  88 RLglTSTSIEIQDRRKMYLTLLIAVIQSLAVSLRLPVQ-SSYSAILVVLMnTILLIAGTFFLVWLSDLNASMGIGGSIVI 166 Streptococcus p...
CAD47181      89 YS--SGVSQKVQQFRQNVVMLVIAIIQGLAIAISFQYH-NGFSLTKLLLA-TMILVTGAYIISWIGNLNAEYGFGGMTIL 164 Streptococcus a...
AAS08374      88 SFgfDALSPKQVQYLMQFLTMIITIIQAALLVFAFTNRrNGLEDFEM----ILILSAGSCLVVWLCYRNMKYGVGASAPV 163 Lactobacillus j...
BAB43751      88 MDkyMKQTSLEKHYKERILTLILSVIQSYFVIHEYVSK-ERVHQDNIYLT-ILILVTGTMLLVWLADKNSRYGIAGPMPI 165 Staphylococcus ...
tigr:SE2280   85 NDkvKTQTRRERHFKERALTLIISAAQGFYIIHSYINK-HAIKDSNMLIL-LLVLITGTLLMVWLADQNTTYGISGPMPI 162 Staphylococcus ...
tigr:SP_1763 167 LLSSMVL----NIPQdVLETFQTVHipTGIIVLLALLTLVFSYLLALMYRARYLVPVNKIGLHNRFKRYSYLEIMLNPAG 242 Streptococcus p...
CAD47181     165 VVVGMLVgqfnNIPL-IFELFQDGY--QLAIILFLLWTLVAMYLMITFERSEYRIPVMRTSIHNRLVDDAYMPIKVNASG 241 Streptococcus a...
AAS08374     164 ILTSILNgaipNIISnVKLLLTMKYawIWLAALAIFILLLIKFWLAFT-KAYYPLKVVNPSLPASSNLMT-VPLGLNMAA 241 Lactobacillus j...
BAB43751     166 VMVSIIK----SMMHqKMEYIDASH---IVIALLIILVIITLFILLFIELVEVRIPYIDLMNVSATNMKSYLSWKVNPAG 238 Staphylococcus ...
tigr:SE2280  163 VLMSLVK----SIFNtHFPKLNSSA---SLITMIIVLLVLALFILFFIELTEYRIEYNDIMNISAKDIPSYLSWKLNPAG 235 Staphylococcus ...
tigr:SP_1763 243 GMPYMYVMSFLSVPAYLFILLGFIFPNHSGLAALSKEFMVGKPLWVYVYISVLFLFSIIFAFVTMNGEEIADRMKKSGEY 322 Streptococcus p...
CAD47181     242 GMAFMYVYTLLMFPQYIIILLRSIFPTNPDITSYNDYFSLSSIQGVVIYMILMLVLSVAFTFVNIDPTKISEAMRESGDF 321 Streptococcus a...
AAS08374     242 MMMYMVGMAILTLP----LMVGRYFSSSSLINNWVFQASFSAVMGILIF--------YFFTFVNFDPKEQAKSFRNNHYY 309 Lactobacillus j...
BAB43751     239 SITLMMSISAFVFLKSGIHFILSMFNKS--ISDDMPMLTFDSPVGISVYLVIQMLLGYFLSRFLINTKQKSKDFLKSGNY 316 Staphylococcus ...
tigr:SE2280  236 SISIMVSLSLFMLTNNIVNFIGRFIVNH---NFETHVFNFTNPVGITIYLLLQMILGYFLSRLLINTKRKSKEFLKNGNY 312 Staphylococcus ...
tigr:SP_1763 323 IYGIYPGADTSRFINRLVLRFSVIGGLFNVIMAGGPMLFVLFDEKLLRLAMIPGLFMMFGGMIFTIRDEVKALRLNETYR 402 Streptococcus p...
CAD47181     322 IPNYRPGKETQSYLSKICYLFGTFSGFFMAFLGGVPLLFALGNDDLRTVSSMTGIFMMITGMSFMILDEFQVIRIRKQYT 401 Streptococcus a...
AAS08374     310 IPNIAPGRPTQRYLNRLIWIIAFPGAVLNAFQLVFGLYGGNFLGNYAGFAIIPMNVVMITMFMGGIKDQIDTILFPYRYD 389 Lactobacillus j...
BAB43751     317 FSGVKPGKDTERYLNYQARRVCWFGSALVTVIIGIPLYFTLFVPHLSTEIYFSVQLIVLVYISINIAETIRTYLYFDKYK 396 Staphylococcus ...
tigr:SE2280  313 FEGIQPGQQTEKFLGSKARRICWFGSIVVAIVLAIPMYSALLVPHLLKEVYFTTQMIVFVYIGINIAETIRAYLYFDSYK 392 Staphylococcus ...
tigr:SP_1763 403 PLI 405 Streptococcus pneumoniae TIGR4
CAD47181     402 SVF 404 Streptococcus agalactiae NEM316
AAS08374     390 RLL 392 Lactobacillus johnsonii NCC 533
BAB43751     397 PFL 399 Staphylococcus aureus subsp. aureus N315
tigr:SE2280  393 QIL 395 Staphylococcus epidermidis RP62A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap