4PQG


Conserved Protein Domain Family
TIGR02918

?
TIGR02918: TIGR02918 
Click on image for an interactive view with Cn3D
accessory Sec system glycosylation protein GtfA
Members of this protein family are found only in Gram-positive bacteria of the Firmicutes lineage, including several species of Staphylococcus, Streptococcus, and Lactobacillus. Members are associated with glycosylation of serine-rich glycoproteins exported by the accessory Sec system. [Protein fate, Protein modification and repair]
Statistics
?
PSSM-Id: 131964
View PSSM: TIGR02918
Aligned: 9 rows
Threshold Bit Score: 835.5
Threshold Setting Gi: 41582768
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4PQG_A            9 MTIYNINLGIGWASSGVEYAQAYRAGVFRKLNLSSKFIFTDMILADNIQHLTANIGFDDNQVIWLYNHFTDIKIAPTSVT 88  Streptococcu...
crjinra:str0413   1 MTVYNINLGIGWASSGVEYAQAYRSTIFKNTGIKAKFVFMDMFLQDNLSDLARNMGFSDEDIIWLYSYFTDLKIAPTTYT 80  Streptococcu...
tigr:SP_1758      1 MTIYNINLGIGWASSGVEYAQAYRAGVFRKLNLSSKFIFTDMILADNIQHLTANIGFDDNQVIWLYNHFTDIKIAPTSVT 80  Streptococcu...
AAZ95532          1 MVVYNLNRGIGWASSGVEYAQAYRSEVFRKLGVEAKFIFTDMFQNENIEHLTRNIGFEDNEIIWLYTFFTDLTIAATSYS 80  Streptococcu...
BAE17255          1 MTIYNINFGIGWASSGVEYAQRYRAQLLRKCNETIKFVFLDFIKNENIQTLTENIGFKNEEIIWLYQYFTDIKIAPTSVT 80  Staphylococc...
AAO05885          1 MTIYNINFGIGWASSGVEYAQVYRAKLLRQLPYPTKFIFLDFIQSENIQTLTSNIGFKDDEVIWLYQYFTDVKIAPTTYT 80  Staphylococc...
BAB43746          1 MTIYNINFGIGWASSGVEYAQAYRAKLLRRTNQDTKFVFLDFIQSENIQTLTQNIGFKDQEVIWLYQYFSDISIAPTTYT 80  Staphylococc...
BAE03350          1 MTIYNLNFGIGWASSGVEYAQLYRRNIFKLMKENFKFIYLDFIQKENIQTLTENLGFEDDEIIWIYQYFTDIKIAPTTYT 80  Staphylococc...
AAS08379          1 MTVYNINLGIGWASSGVEYAQKYRDQSFDKVGIERKFIFSDLILGNNIGDLTANLGFDNDNIIWLYNFFTDVKSSTSNYS 80  Lactobacillu...
4PQG_A           89 VDDVLAYFGGEESHREK-NGKVLRVFFF-DQDKFVTCYLVDENKDLVQHAEYVFKGNLIRKDYFSYTRYCSEYFAPKDNV 166 Streptococcu...
crjinra:str0413  81 VKDLEKEIPYDITRREI-NGKVVKLFCT-KEDIFYAAYLRKEGEDIVHRVEKVSRGCLIRKDFYSYTKMFTEYYTPVDNK 158 Streptococcu...
tigr:SP_1758     81 VDDVLAYFGGEESHREK-NGKVLRVFFF-DQDKFVTCYLVDENKDLVQHAEYVFKGNLIRKDYFSYTRYCSEYFAPKDNV 158 Streptococcu...
AAZ95532         81 LQQLKESFSLPIDRTEK-NGKIISFFFK-GSSIVVTVMLNDESSNIVQRVEYLMGGKLVRKDYYSYTKMFSEYYAPEDIG 158 Streptococcu...
BAE17255         81 VDEIIKPLYSEITKVEN-QGKTRKIHFN-HNSNYLVCYLKNEDSDVVDRVEYISRGKLLRRDYYSYVRVLSEYFAPEDNS 158 Staphylococc...
AAO05885         81 VDDLISELGNEVTRKEQ-NGKVLRLYLN-NQQTFVTCYLKNANEHYVDRAEFVVNGMLIRKDFYSYVRTFSEYYAPFNNK 158 Staphylococc...
BAB43746         81 LDDIERELGHEISFRER-NGKIVRLYFN-GKSSFVTCYLQNEQKDVVDRAEFVINSMLVRKDFYSYTRIFSEYYAPADNK 158 Staphylococc...
BAE03350         81 IQNIIDRLEDTNVEIERvNNKIKKIIFG-NDNNYIRCYLKNESENIVDRAEYVSKGKLIKKEFYNFTIVFTEYYAPYEKK 159 Staphylococc...
AAS08379         81 LDTLENELNLKKLSSNV-KTVGKEVFYQlNDGLQLVARLSDAEKRTIDQVSYVKNNTLLKRDFYSYTKYACEYYLGADKD 159 Lactobacillu...
4PQG_A          167 AVLYQRTFYNEDGTPVYDILMNqGKEEVYHFKD-KIFYGKQAFVRAFMKSLNLNKSDLVILDRETG-----IGQVVFEEA 240 Streptococcu...
crjinra:str0413 159 AHLYQRRFFNEDGSIAYDEIVD-GKDSVFRFPD-KILSSKQEFIAYFMSQLGLTDQDIVILDRATG-----TGQAVFRNT 231 Streptococcu...
tigr:SP_1758    159 AVLYQRTFYNEDGTPVYDILMNqGKEEVYHFKD-KIFYGKQAFVRAFMKSLNLNKSDLVILDRETG-----IGQVVFEEA 232 Streptococcu...
AAZ95532        159 PCLYQRTFYNEDGSVAYEENVD-GENSIFKFKE-TILYSKEELVGYMLEKLQLTNSDLILLDRSTG-----IGQAVLRNK 231 Streptococcu...
BAE17255        159 AKLYMRSFYNEDGSIAYNEYVN-DEESMFVFED-NILYGKQALIACFLEKLHLTDKDMLIVDRSKD-----IGQTVLQNK 231 Staphylococc...
AAO05885        159 AKIYMRQFYNENGSIAYREYID-EDEHVFVFDD-ARLYSKQALVAYFIRQLLLNSEDIIIIDRATD-----VGQAILENK 231 Staphylococc...
BAB43746        159 AKLYMRQFYNEDGSIAYNEYID-GDSSIYVFED-AVLYNKTEFIAYFLQRLNLTRDDIVILDRASD-----IGQAVLQHK 231 Staphylococc...
BAE03350        160 AKLYLRTYFNEDGSIAYEEHIS-GKNSIFVFPN-VILYSKLEFIAYFLRQLNLTREDILLIDRSKN-----IGQVILENK 232 Staphylococc...
AAS08379        160 NRVTFREFYNEDGTIAYTQHLN-GDQETFEFANgEVIYSKDDLYLKMLKELNFTKKDVIILDREDEdknliNGQLVFENH 238 Lactobacillu...
4PQG_A          241 QTAHLAVVVHAEHYSENATNEDYILWNNYYDYQFTNADKVDFFIVSTDRQNEVLQEQFAKYTQHQPKIVTIPVGSIDSLT 320 Streptococcu...
crjinra:str0413 232 KPAKLGVVVHAEHFSENAVTDKTILWNNFYEYQFSNADKVDFFITATECQRSIMLDQFNKYTPFKPHIVTIPVGSVDKLR 311 Streptococcu...
tigr:SP_1758    233 QTAHLAVVVHAEHYSENATNEDYILWNNYYDYQFTNADKVDFFIVSTDRQNEVLQEQFAKYTQHQPKIVTIPVGSIDSLT 312 Streptococcu...
AAZ95532        232 GNAKVAVVVHAEHYNVSATDETTILWNNYYDYQFSNADSIDAFITSTETQTKTLIDQFKKYLNIEPVVYTIPVGSLSKLQ 311 Streptococcu...
BAE17255        232 GPARLGVVIHAEHYNESTTNDTYILWNNHYEYVFMNAHEIDFFITATDIQNQLLAQQFEKNYHRKPKIYTIPVGSLSTLV 311 Staphylococc...
AAO05885        232 GSSKVGVVVHAEHFSEGATDGTHILWNNYYEYQFENAQHIDFFITATDLQRQTLSEQFKQYKNDCPRIRTIPVGSIESLQ 311 Staphylococc...
BAB43746        232 GDSKVGVVIHADHYSNNMMSEQHILWNNYYEYQFSKAKYIDFFITATDIQNHMVCRQFEQYQGYRPRVYTIPVGSIDALS 311 Staphylococc...
BAE03350        233 NQARLGVVIHAEHFNHSNTNEDYILWNNNYEYMFNHVDYIDFFITATDAQKQLIVNQFNQYKNKNPKVYTIPVGSLKELK 312 Staphylococc...
AAS08379        239 GPAKLVVVVHADHFDKHYTTDQNILWNNFYEYQFQHAKYVDSFIVATNEQKKILKNQFKKYYNIEPRIDCIPVGSLNELE 318 Lactobacillu...
4PQG_A          321 DSS-QGRKPFSLITASRLAKEKHIDWLVKAVIEAHKELPELTFDIYGSGGEDSLLREIIANHQAEDYIQLKGHAELSQIY 399 Streptococcu...
crjinra:str0413 312 EPE-GERKPFSIITASRLANEKHVDWLVKAVVKAKESLPQVNFDIFGTGAEESKLKAIIEENQAQDYIHLKGHQDLIEVY 390 Streptococcu...
tigr:SP_1758    313 DSS-QGRKPFSLITASRLAKEKHIDWLVKAVIEAHKELPELTFDIYGSGGEDSLLREIIANHQAEDYIQLKGHAELSQIY 391 Streptococcu...
AAZ95532        312 RKEwHERKAFSLLTCSRLASEKHIDWLINAVVEANKVIPELTFDIYGEGGERQKLQEIIAKNKANNYIRLMGHKNLSSVY 391 Streptococcu...
BAE17255        312 KP--NRRKPYSIITASRLATEKHVDWLVKAVLKAKASVPEITFDIYGEGGQRQLLSKLIQENHAEDYITLKGHVNLNQVY 389 Staphylococc...
AAO05885        312 YPE-KERKPYSIMTASRLANEKHVDWIVEAVIKAKHQLPQLSFDIYGQGEEQEKIKNIITKHRAEDYIQIKGHRNLRTIY 390 Staphylococc...
BAB43746        312 YPK-LSRKPYAMISASRLANEKHIDWLVKAVIVAKRQVPELTFDIYGEGSEKTRLRKIIDTHRAQDYIRLLGHVKLDEIY 390 Staphylococc...
BAE03350        313 YT--HERASNSIMTASRLAKEKHVDWLIESVVQAHKTRPSIKFDIYGEGAEKNNLQKLINEKEANEYIKLRGHKNLEEIY 390 Staphylococc...
AAS08379        319 HPT-QGRMKHSLITASRLAKEKHIDWIVNAVVAAKNSVPDLSLDIYGTGGEAGMLTNLINQNQAQDYIHIMGQRDLTKVY 397 Lactobacillu...
4PQG_A          400 SQYEVYLTASTSEGFGLTLMEAIGSGLPLIGFDVPYGNQTFIEDGQNGYLIP-SSSDHVEDQiKQAYAAKICQLY-QENR 477 Streptococcu...
crjinra:str0413 391 KDYELYLSGSKSEGFGLTLLEAVGSGLGMIGFDVRYGNQTFIKDNENGYLIP-RFEKDDEPAiVAALAEKIVAFF-NRSD 468 Streptococcu...
tigr:SP_1758    392 SQYEVYLTASTSEGFGLTLMEAIGSGLPLIGFDVPYGNQTFIEDGQNGYLIP-SSSDHVEDQiKQAYAAKICQLY-QENR 469 Streptococcu...
AAZ95532        392 KDYQVYLSGSTSEGFGLTLMEAIGSGLPIIGLDVPYGNQTFIENNLNGYLIP-RETPDNPQQiSTAFAQYIVALF-NSKD 469 Streptococcu...
BAE17255        390 QDYELFLSGSTSEGFGLTLMEAIGSGLGMIGFDVNYGNPTFIKHQKNGYLIPiDLNEDKESEiIDHLAEGIVNYF--DND 467 Staphylococc...
AAO05885        391 QQYELFIAASQSEGFGLTLMEAVGSGLGMIGFDVNYGSPTFIRHHQNGYLIPiDFEQASTDDiTTQIAHMIIRYF--EDG 468 Staphylococc...
BAB43746        391 NDYELFLSASTSEGFGLTLMEAVGSGLGMIGLNVNYGNPTFIRDGENGYLVPfDTDEDSVDDvIAKLAHAIVMYF--NNG 468 Staphylococc...
BAE03350        391 KKYQLYLSGSTSEGFGLTLMEAIGSGLGIIGFDVNYGNTTFIKDRYNGYRIPeSIKNQGTKEiATKFAEKIDEYFvSSNK 470 Staphylococc...
AAS08379        398 RNYPAYIAASTSEGFGLSLLEAVGSGLAMIGFDVPYGNPTFIENEKNGMLLPyNEEWTDFRK-EEVLTKAIIEMF-TKSD 475 Lactobacillu...
4PQG_A          478 LEAMRAYSYQIAEGFLTKEILEKWKKTVEEV 508 Streptococcus pneumoniae TIGR4
crjinra:str0413 469 LDHIHQVSYDIAKGFLTEEIEQKWLNLVREM 499 Streptococcus thermophilus CNRZ1066
tigr:SP_1758    470 LEAMRAYSYQIAEGFLTKEILEKWKKTVEEV 500 Streptococcus pneumoniae TIGR4
AAZ95532        470 ICKKHEYSYRIASRFLNDKIIENWSFFLRRL 500 Streptococcus agalactiae
BAE17255        468 TSRFNQASYEIAENFTQPVVVQKWNNLISEV 498 Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305
AAO05885        469 PIRAHEVSYDIAESFKTSHIVDLWRQLIEEV 499 Staphylococcus epidermidis ATCC 12228
BAB43746        469 PQAPHDISYEVAQQFMTQDIILKWETLVQEV 499 Staphylococcus aureus subsp. aureus N315
BAE03350        471 IDQMSHESYLIADDFLLNNCKEKWLSLVNEV 501 Staphylococcus haemolyticus JCSC1435
AAS08379        476 VDSFNKKSYQIAEPYLTANVAKQWKKLVGGI 506 Lactobacillus johnsonii NCC 533
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap