Conserved Protein Domain Family
sulfite_red_C

?
TIGR02912: sulfite_red_C 
sulfite reductase, subunit C
Members of this protein family include the C subunit, one of three subunits, of the anaerobic sulfite reductase of Salmonella, and close homologs from various Clostridum species, where the three-gene neighborhood is preserved. Two such gene clusters are found in Clostridium perfringens, but it may be that these sets of genes correspond to the distinct assimilatory and dissimilatory forms as seen in Clostridium pasteurianum. Note that any one of these enzymes may have secondary substates such as NH2OH, SeO3(2-), and SO3(2-). Heterologous expression of the anaerobic sulfite reductase of Salmonella confers on Escherichia coli the ability to produce hydrogen sulfide gas from sulfite. [Central intermediary metabolism, Sulfur metabolism]
Statistics
?
PSSM-Id: 131958
View PSSM: TIGR02912
Aligned: 4 rows
Threshold Bit Score: 546.771
Threshold Setting Gi: 60391778
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAK79482       2 DINTKNLK-KNAFRVTKRRGITASRIRVPGGHLEAKFLSMIQNIAENYGDGSVHITSRQGFEIPGIKFEDMPKVNELLQP 80  Clostridium ace...
P0A1Y2         4 DIDIIKARaKNEYRLSKVRGEAMISVRIPGGILPAHLLTVARDIAETWGNGQIHLTTRQKLAMPGIRYEDIDNVNAALEP 83  Salmonella ente...
AAO36947       2 DINTKALK-KNAFRVTKERGKTAARVRVPGGYLDAKYLSLLQNIAETYGNGKLHITIRQGFEIPGIPMKYIPEVNKALQP 80  Clostridium tet...
WP_011948643   2 DINTKAIK-KNAFRVTKHRGKTALRVRVPGGNLPVKYFAILAKIAEEYGNGKVHVTTRQGFEIPDLDFNKMDEINKLIQP 80  Clostridium bot...
AAK79482      81 IIEGLNINQETALQ-----GYSASGTRNITACVGNRVCPYGCYDTTSFAQRIEKAVFPHDLHFKIALTGCPNDCAKVRMH 155 Clostridium ace...
P0A1Y2        84 FLREIEIELCDVQVedtkaGYLAIGGRNIVACQGNRICQKANTDTTGLSRRLEKLVYPSPYHLKTVIVGCPNDCAKASMA 163 Salmonella ente...
AAO36947      81 IIEGLEINQENPNK-----GYSASGTRNVSACIGNNVCPFANYNTAKFAKKIEKAIFPNDYHVKIALTGCPNDCIKARMQ 155 Clostridium tet...
WP_011948643  81 VIEGLNISQDEVGK-----GYSAAGTRNVTSCIGNEVCPFANYNTTKFAKRIEKAIFPNDYHVKVALTGCPNDCIKARMH 155 Clostridium bot...
AAK79482     156 DFGIMGMTEPHYESDTCVSCGACVKVCKKKSVGALSAVNYKVVRRGEKCIGCGECVLKCPTGAWTRSEKTYYRLTLLGRT 235 Clostridium ace...
P0A1Y2       164 DLGIIGVAKMRFTADRCIGCGACVKACSHHAVGCLALKNGKAVKEESACIGCGECVLACPTLAWQRKPDQLWQVRLGGRT 243 Salmonella ente...
AAO36947     156 DFGIIGMTEPQYDAYRCIGCQACVNVCKKKSTGALSFENYKVVRDHSKCIGCGECINKCPTSAWSRSEEKYFKLVIMGRT 235 Clostridium tet...
WP_011948643 156 DFGILGMTEPQYDKYRCVGCQACVNNCKKRATGALRFENFKVIRDHEKCIGCGECIGKCPTGAWTRSKEKYYKLAIMGRT 235 Clostridium bot...
AAK79482     236 GKKNPRLGEDFIKWVDEDSIIKIILNTYDYvtkyiDPNAPGGKE---HIGYIVDRTGFEEFKKWALKDVKLPSIAEVYTP 312 Clostridium ace...
P0A1Y2       244 SKKTPRVGKLFLNWVTEDVIKQVIVNLYEF-----EKEMLGGKPiylHMGHLIDKGGYLRFKERVLRGVQLNPEAMVAER 318 Salmonella ente...
AAO36947     236 GKKNPRIARDFITWIDEDSIVKIILNTYDYideyiDRNAPGGKE---HIGYIVDRTGYQEFKKWALKDIELSPKAKVEHN 312 Clostridium tet...
WP_011948643 236 GKKNPRLAEDFIKWVDEDSIVKIIINTYDYiheyiDKDAPGGKE---HIGYIVDRTGYQEFKKWALKDVNLKEKAELAEN 312 Clostridium bot...
AAK79482     313 IYW 315 Clostridium acetobutylicum ATCC 824
P0A1Y2       319 IYW 321 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
AAO36947     313 INW 315 Clostridium tetani E88
WP_011948643 313 INW 315 Clostridium botulinum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap